KEGG   Stenotrophomonas maltophilia R551-3: Smal_1259Help
Entry
Smal_1259         CDS       T00733                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
smt00900  Terpenoid backbone biosynthesis
smt01100  Metabolic pathways
smt01110  Biosynthesis of secondary metabolites
smt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Smal_1259
Enzymes [BR:smt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Smal_1259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ACF50964
JGI: Smal1259
UniProt: B4SQ16
Position
complement(1433882..1435072)
Genome map
AA seq 396 aa AA seqDB search
MNAVADLRRVAVFGATGSIGASTLDVIARHPQRYRATVLAAGRQVQALLALCRQHQPEHA
VIADESLFAELRDGLRQAGLSTEAHAGHAALDQLAASDACDTVVAAIVGAAGLSSTLAAA
AAGKRILLANKESLVLAGELLTRTAQQAGAEIIPIDSEHSAIFQCLRSRDASVDGAGVRR
ILLTASGGPFRGRSRADLAAVTPAQAVAHPKWSMGPKISVDSATLMNKGLEVIEAHHLFG
VPGERIDVLVHPQSLVHSLVEFVDGSTLAQMGLPDMRTTLAVGLGWPQRIESGVAGLDLL
AQGRLDFEAPDTEAFPCLALAWQAMQAGGTAPAVLNAANEEAVSAFLQGRIGFLTIPELV
ANALSTLPTQAADTLEVLLSADQRARQLTLNTIAAA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgtcgcagacctgcgccgggtcgccgtgttcggcgccaccggctcgatcggt
gcctccacgctcgacgtgatcgcccgccatccgcagcgttaccgggccaccgtgctcgcc
gccggccgccaggtgcaggcgctgctggcgctgtgccggcagcaccagccggagcatgcg
gtgatcgccgacgaatcgctgtttgccgagctgcgcgacggcctgcgccaagccggcctg
tccaccgaggcccacgccggccatgccgcgctggaccagttggctgccagcgacgcctgc
gacaccgtagtcgcggcgattgtcggtgccgccgggctgtcctcgaccctggccgctgct
gcagccggcaagcgcatcctgctggccaacaaggaatcactggtgctggccggcgaactg
ctgacccgtactgcccagcaggcgggcgccgagatcatcccgatcgacagcgagcacagc
gcgatcttccagtgcctgcgctcgcgcgacgccagtgtcgatggcgccggcgtgcgtcgc
atcctgctcactgcgtccggcggtccattccgcggccgcagccgcgccgacctcgccgcg
gtcaccccggcgcaggccgtagcccacccgaagtggtcgatgggcccgaagatctcggtc
gattcggcgacgttgatgaacaagggcctggaagtgatcgaggcccaccacctgttcggc
gtccccggcgagcgcattgacgtgctggtgcacccgcagagcctggtccattcgctggtc
gagttcgttgacggttcgaccctggcccagatgggcctgccggacatgcgcaccaccctg
gccgttggcctcggctggccgcagcgcatcgaatcgggcgtggccgggctggacctgctg
gcgcagggccggctcgatttcgaggccccggataccgaggccttcccgtgcctggcgctg
gcctggcaggccatgcaggccggcggcaccgccccggccgtgctgaacgccgccaatgaa
gaggcggtttcagcgtttcttcagggccggatcggtttcctgaccattccggaactggtt
gctaacgctctttcaacactgccgacccaagcagccgatacacttgaggttctgttgtcc
gccgaccagcgggcacgccagctcaccctgaacaccatcgccgccgcctga

DBGET integrated database retrieval system