KEGG   Stenotrophomonas maltophilia R551-3: Smal_1278Help
Entry
Smal_1278         CDS       T00733                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
smt00300  Lysine biosynthesis
smt01100  Metabolic pathways
smt01120  Microbial metabolism in diverse environments
smt01230  Biosynthesis of amino acids
Module
smt_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Smal_1278
Enzymes [BR:smt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Smal_1278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ACF50983
JGI: Smal1278
UniProt: B4SQ35
Position
1453713..1454840
Genome map
AA seq 375 aa AA seqDB search
MSAVLDLTCELIARPSVTPDDAGCQTLLAARLKQAGFQCDHLRLGEVDNLWATHGQGAPV
LVLLGHTDVVPPGPREAWASDPFTPQIREGVLYGRGTADMKGSVAAFVVAAEQFVAAHPD
HTGTLAVLLTSDEEGDAIDGVRHVARLFAERGQRIDWCITGEPSSTATLGDLLRVGRRGS
LSAKLRVQGVQGHVAYPEKARNPIHQAAPALAELSARRWDDGYESFPPTSLQISNIHAGT
GANNVIPGELEVDFNIRYNPHWDAPKLEAEITALLDQHGLQYTLKWHRSGEPFYTPEGTL
RATARAVLAEHIGRAPEESTGGGTSDARFIAPLGAQCIEVGPVNASIHQVDENVRVDELE
ALPGLYQRLVERLLV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcggtcctcgacctgacctgcgaactgatcgcacgaccctcggtgacgccggat
gatgctggctgccagacactgctggcggcacgcctgaagcaggccgggttccagtgcgat
cacctgcgcctgggcgaggtcgacaacctgtgggcgacccatgggcagggtgcgccggtg
ctggtgctgctgggccacaccgacgtggtgccgcccggcccgcgcgaggcctgggccagc
gatccgttcacgccgcagatccgtgagggtgtgctgtacggccgtggcaccgccgacatg
aagggcagcgtggcggcgttcgtggtggccgccgagcagttcgtggccgcgcatcccgat
cataccggcacgctggcggtgctgctgaccagcgacgaggagggcgatgccatcgatggc
gtgcgccacgttgcacggctcttcgccgagcgcggccagcgcatcgactggtgcatcacc
ggcgagccgtcgtcgaccgcgacgctgggtgacctgctgcgcgtgggtcgtcgcggcagc
ctgtcggccaagctgcgcgtgcagggcgtgcagggtcatgtggcgtatccggagaaggca
cgtaacccgatccaccaggcggcgccggccctggccgagctgagtgcgcggcgctgggat
gacggctacgagagtttcccgccgaccagcctgcagatctccaacatccatgccggtacc
ggtgccaacaatgtgattcccggcgagctggaggtggatttcaacatccgctacaacccg
cactgggatgcgccgaagctggaggcggagatcactgcactgttggaccagcatggcctg
cagtacacgctcaagtggcatcgcagcggtgagccgttctacaccccggaaggcacgctg
cgtgcgactgcgcgcgcggtactggccgagcacatcggccgcgcaccggaagaaagcacc
ggcggaggcacctccgatgcacgcttcatcgcgccgctgggcgcgcagtgcatcgaagtg
gggccggtcaacgccagcatccaccaggtggacgagaacgtgcgcgtggacgagctggaa
gcactgccggggttgtaccagcggctggtggaacggttgctggtgtga

DBGET integrated database retrieval system