KEGG   Stenotrophomonas maltophilia R551-3: Smal_1459Help
Entry
Smal_1459         CDS       T00733                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
smt  Stenotrophomonas maltophilia R551-3
Brite
Enzymes [BR:smt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Smal_1459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1643904..1644581
Genome map
AA seq 225 aa AA seqDB search
MSPRLRLQPEAVGIGMTSQRVRDRLVDRLREAGIVDESTLNAIRVVPRHLFIDEALASRA
YEDTALPIGHGQTISQPWVVARMTEAVLQVAPKRVLEVGTGSGYQAAVLGALGLEVYTVE
RIGDLLRQARKRFRALGMNIRTKHDDGRVGWAEHGPFDAIVVTAAAPALVDVLIEQLAEG
GRLVAPVGGPSAQSLVQLDRRADGSIEQHVLAPVTFVPLLSGMLD
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgcgcctgcgcctgcaaccggaagccgtcggtatcggcatgacctcgcaacgt
gtgcgcgaccgtctggtcgaccgcctgcgtgaagcaggcatcgtcgacgaatcaaccttg
aatgcgatccgggtggtgccgcgccatctgttcatcgatgaggcgctggcgtcacgcgcc
tacgaagacaccgcactgccgatcggccatggccagaccatttcgcaaccctgggtggtg
gcgcggatgaccgaggccgtgctgcaggtggcacccaagcgggtgctggaagtgggtacc
ggttcgggctaccaggccgccgtgctcggtgcactgggcctggaggtctacaccgtcgag
cgcatcggcgacctgctgcgccaggcgcgcaagcgctttcgtgcgctgggcatgaacatc
cgtaccaagcatgatgacggccgcgtcggttgggccgagcacggtccgttcgatgccatc
gtggtcactgcagcggcgccggcgctggtcgatgtactgatcgagcagctcgctgaaggc
ggccgcctggtggccccggtcggcggccccagtgcgcagtcgctggtgcagctggaccgc
agggccgacggcagcatcgaacaacacgtgctggcgccggtcaccttcgtaccgctgctg
tctggcatgctggactaa

DBGET integrated database retrieval system