KEGG   Stenotrophomonas maltophilia R551-3: Smal_1469Help
Entry
Smal_1469         CDS       T00733                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
smt00790  Folate biosynthesis
smt01100  Metabolic pathways
Module
smt_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Smal_1469
Enzymes [BR:smt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Smal_1469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind CdhD
Motif
Other DBs
NCBI-ProteinID: ACF51174
JGI: Smal1469
UniProt: B4SRA3
Position
1652147..1653043
Genome map
AA seq 298 aa AA seqDB search
MFDTSPQLDCAGRILRLDRARVMGIVNVTPDSFSDGGAHDTTEAAVSHGLRLVEEGADLL
DIGGESTRPGAAPVSIEEELRRVIPVIEQLAARTQVPISIDTFKPEVMRAAVAAGAGMIN
DIFGLRQEGALDAAAEAGVPVVLMHMQGEPGHMQADPHYDDVVGEVHGFLVQRLFAAEMA
GIAKKNLLIDLGFGFGKTTAHNMTLLARSERFLELGVPMLAGLSRKRSLGELTGRDTPSE
RVAASVAAHLIAVQRGARIVRVHDVAATVDALKIWQAVQAVPTPRADATPTIRWPDED
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatacctcgccccagctcgattgcgccggccgcatcctgcgcctcgaccgtgcc
cgggtcatgggcatcgtcaacgtcaccccggactcgttctccgatggcggcgcacacgac
accaccgaagcggcggtctcgcatggcctgaggctggtcgaggagggcgctgacctgctc
gacatcggcggcgaatccacgcgcccgggcgccgctccggtctcgattgaagaagaactg
cgccgcgtgatcccggtgatcgagcagttggccgcccgaacccaggtgccgatcagcatc
gacaccttcaagcccgaggtgatgcgggcggcagtggccgccggcgccggcatgatcaac
gacatctttggcctgcgccaggaaggtgcgttggacgcggctgccgaggcaggcgtgccg
gtggtgctgatgcacatgcagggcgagccgggccacatgcaggccgatccgcactacgac
gacgtggtcggcgaggtgcatggcttcctggtgcagcgcctgttcgccgcggaaatggcc
ggcatcgcaaagaagaacctgctgatcgacctcggtttcggcttcggcaagaccactgcc
cacaacatgaccctgctggcgcgttcggagcgcttcctggaactgggtgtgccgatgctg
gctggcctgtcgcgcaagcgcagcctgggagaactcaccggccgcgatacgccctccgaa
cgggtggcggcgtcggtagccgcgcacctgattgcggtccagcgtggcgcgcgcatcgtg
cgcgtgcatgacgtggccgccacggtcgacgcactgaagatctggcaggcagtgcaggcc
gtaccgacgccgcgcgccgacgccacgccgacgatccgctggccggacgaagactga

DBGET integrated database retrieval system