KEGG   Stenotrophomonas maltophilia R551-3: Smal_1536Help
Entry
Smal_1536         CDS       T00733                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
smt00020  Citrate cycle (TCA cycle)
smt00190  Oxidative phosphorylation
smt00650  Butanoate metabolism
smt01100  Metabolic pathways
smt01110  Biosynthesis of secondary metabolites
smt01120  Microbial metabolism in diverse environments
smt01130  Biosynthesis of antibiotics
smt01200  Carbon metabolism
Module
smt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
smt_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Smal_1536
   00650 Butanoate metabolism
    Smal_1536
  Energy metabolism
   00190 Oxidative phosphorylation
    Smal_1536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ACF51241
JGI: Smal1536
UniProt: B4SS02
Position
1732197..1732583
Genome map
AA seq 128 aa AA seqDB search
MSKFRTPLKGVRGLGSAKTGTEHFVHQRLTAAALVALGIWFLVFVLGLLGSDYATAAAAV
AKPWNAVPLIGLLIAMFWHAQLGMQVVLEDYIHESLLALVLQTAVKFVAVLGMIVSVFAV
GRIALGVA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaagttccgtactccgctgaagggtgtgcgcggccttggttcggccaagaccggc
accgagcacttcgtgcaccagcgcctgaccgccgccgccctggtggcgctgggcatctgg
ttcctggtcttcgtgctgggcctgctgggctcggactacgcgaccgccgccgccgccgtg
gccaagccgtggaacgcagtgccgctgatcggcctgctgatcgccatgttctggcacgcg
cagctcggcatgcaggtcgtgctggaagactacatccacgaatcgctgctggccctggtg
ctgcagaccgcggtgaagttcgtcgccgtgctcggcatgatcgtcagtgtgtttgcggtg
ggccgcatcgccctcggcgttgcctga

DBGET integrated database retrieval system