KEGG   Stenotrophomonas maltophilia R551-3: Smal_1652Help
Entry
Smal_1652         CDS       T00733                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Smal_1652
   00052 Galactose metabolism
    Smal_1652
   00500 Starch and sucrose metabolism
    Smal_1652
   00520 Amino sugar and nucleotide sugar metabolism
    Smal_1652
Enzymes [BR:smt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Smal_1652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1860624..1861502
Genome map
AA seq 292 aa AA seqDB search
MSKRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDRPLIQYAVDEAIEAGCDTLVFITNR
YKHAVADYFDKAYELEQKLERAGKLEQLELIRHVLPNGVRAIFVTQAEALGLGHAVLCAK
AVIGDEPFAVLLPDDLIWNRGDGALKQMADLNEASGASVIAVEDVPHDKTASYGIVATDA
FDGRKGRISQIVEKPKPEDAPSDLAVVGRYVLSPKIFELLEQTGSGAGGEIQLTDAIAQL
LKTEEVDAYRFEGTRFDCGTHLGLVEATIRFALDNPKLAGPAREKLAAMLAE
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcgaattcgcaaggcagttttcccggtggcaggactggggacgcgttttctg
ccagcaaccaagaccgttccgaaggaaatgctgccgatcatcgaccggccgctgatccag
tacgcggtggatgaagcgatcgaggcgggctgcgacacgctggtgttcatcaccaaccgc
tacaagcatgcggtggccgattatttcgacaaggcctacgaactggagcagaagctcgag
cgcgctggcaagctggagcagctggagttgatccgtcatgtgctgcccaacggcgtccgc
gcgatcttcgtgacccaggctgaagcactgggcctgggccatgcggtgctgtgtgccaag
gcggtgatcggcgacgaaccgttcgcggtactgctgccggacgacctgatctggaaccgt
ggcgatggcgcgctgaagcagatggccgacctcaacgaagccagcggtgccagcgtgatc
gcggtggaagacgtgccgcatgacaagaccgccagctacggcatcgttgccaccgatgcg
ttcgatggccgcaagggccgtatttctcagatcgtggagaagccgaagccggaggacgcg
ccgagcgacctggccgtggtcggccgctacgtgctgagcccgaagatcttcgagctgctg
gagcagaccggcagtggtgccggtggcgagatccagctgaccgacgcgatcgcgcagctg
ctgaagaccgaagaggtggatgcctatcgtttcgagggcacccgtttcgactgcggtacg
cacctggggctggtggaggcgacgatccgcttcgcgctggacaacccgaagctggccggc
ccggcacgcgagaagctggcggcgatgttggcggaataa

DBGET integrated database retrieval system