KEGG   Stenotrophomonas maltophilia R551-3: Smal_1682Help
Entry
Smal_1682         CDS       T00733                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
smt00072  Synthesis and degradation of ketone bodies
smt00650  Butanoate metabolism
smt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Smal_1682
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Smal_1682
Enzymes [BR:smt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Smal_1682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR CbiG_C
Motif
Other DBs
NCBI-ProteinID: ACF51386
JGI: Smal1682
UniProt: B4SSY7
Position
1895255..1896037
Genome map
AA seq 260 aa AA seqDB search
MFSGKVAVVTGSTSGIGLGIATALARQGADIVLNGFGDAAEIERIRSNLEAEFGVRVAHD
GADLSRGEAVRGMIDHAVAKMGRIDILVNNAGIQHTASIEEFPTEKWDAIIALNLSAVFH
ATAAALPHMKRRGAGRIINIASVHGLVGSVNKSAYVAAKHGVVGFTKVTALENAGTGITA
NAICPGWVRTALVEQQITALAEREGTDQETAARALVAEKQPSLQFVTPEQLGEMVVFLAS
DAAAQITGTALPVDGGWTAR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgttcagtggaaaggtcgcggtggttaccggctccacaagcggtatcggtcttggcatt
gccacggcgctggcgcggcaaggcgccgacatcgtgttgaacggattcggcgatgcggcg
gagatcgaacgtatccgttccaacctggaagccgagttcggtgttcgcgtggcgcatgac
ggtgccgacctgtcccgtggcgaggcagtgcgcgggatgatcgaccacgccgttgcgaag
atggggcgcatcgacattctggtgaacaacgcgggcatccagcacaccgcgtcgatcgag
gaattccccacagagaaatgggatgcgatcatcgcgctgaatttgtcggcggtgttccat
gcaacggcggcagccttgccccacatgaagcggcggggcgccggccgcatcatcaacatc
gcatccgtgcacgggttggtgggctcggtgaacaagtcggcctacgtggcggccaagcat
ggcgtggtggggttcaccaaggtgaccgcgctggagaacgcgggcactggcatcaccgcc
aacgcgatctgcccgggttgggtgcgaactgcgctggtcgagcagcagatcaccgcgttg
gccgagcgcgaaggcacggatcaggagaccgctgcgcgtgcgctggtggccgagaaacag
ccctcgctgcagttcgtgacgcccgagcagctgggggaaatggtggtgttcctggcctcg
gacgccgcggcgcagatcaccggcacggcgttgccggtcgatggtggctggaccgcccgc
tag

DBGET integrated database retrieval system