KEGG   Stenotrophomonas maltophilia R551-3: Smal_1781Help
Entry
Smal_1781         CDS       T00733                                 

Definition
Acireductone dioxygenase ARD
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Smal_1781
Enzymes [BR:smt01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Smal_1781
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Smal_1781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2001444..2002001)
Genome map
AA seq 185 aa AA seqDB search
MSRLRIYDDTRPESPLLDTQDGAIIAAELQKIGVTFERWQATAPVAPGASQEEVFAAYRA
DIDRLVAERGFKSVDVASIAPDNPNRAELRRKFLDEHFHKEDEVRFFVAGSGLFTLHVGD
KVYEIECVKDDLIAVPDGTTHWFDMGDEPSFVAIRFFTEPDGWVGHFTGTDIAQKFPRYV
PTQAS
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgagccgactgcgcatctacgacgacacccgccccgaatcgccgctgctggacacccag
gacggcgcgatcatcgctgccgagctgcagaagatcggcgtcaccttcgagcgctggcag
gccaccgcgccggtcgcgccgggcgccagccaggaggaagtgttcgccgcttaccgcgcc
gacatcgaccgcctggtggccgagcgcggcttcaagagcgtggacgtggcctcgatcgcc
ccggacaacccgaaccgcgccgagctgcgcaggaagttcctcgacgaacacttccacaag
gaagacgaggtgcgcttcttcgtcgcaggctccggcctgttcacgctgcacgtgggtgac
aaggtctatgagatcgagtgcgtgaaggacgacctgatcgccgtgcccgacggcaccacc
cactggttcgacatgggcgatgagcccagcttcgtggcgatccgcttcttcaccgagccg
gacggctgggtcggccacttcaccggcaccgacatcgcgcagaagttcccccgttacgta
cctacccaggcgtcctga

DBGET integrated database retrieval system