KEGG   Stenotrophomonas maltophilia R551-3: Smal_2618Help
Entry
Smal_2618         CDS       T00733                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Smal_2618
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Smal_2618
Enzymes [BR:smt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Smal_2618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2925012..2925599)
Genome map
AA seq 195 aa AA seqDB search
MPLPTVSSRRLRGLSLLVLMVAGAAGSGSALAADLLDLDYRPLAGKQQVNLQQRYQGQVL
LVVNTASKCGYTPQYEGLEALQKRYAGRGFAVLGFPSNDFKGQEPGDEKQIQDFCTLTYG
VKFPMFEKVHVVGAQATPLYQRLSAATGVAPAWNFHKYLVGRDGKVIAQFASKVTPDDAQ
LTAAIDKALAAAATH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgccgactgtttcctcgcgccgcctgcgcggcctgtccctgctggtcctgatg
gtggccggcgctgctggttccggcagtgcccttgctgccgatctgctcgacctggattac
cggccgctggccggcaagcagcaggtcaacctgcagcagcgctaccaggggcaggtgctg
ctggtggtcaacaccgccagcaagtgcggctataccccgcagtacgaagggctggaagcg
ctgcagaagcgctatgcggggcgtggcttcgccgtgcttggtttcccgtccaatgatttc
aagggccaggagccgggtgacgagaagcagatccaggatttctgcacgctgacctacggc
gtcaagttcccgatgttcgagaaggtgcatgtggtgggggcgcaggcaacgccgctttac
cagcggctgagcgcagccaccggcgtagccccggcctggaacttccacaagtacctggtc
ggccgcgatggcaaggtcatcgcccagttcgccagcaaggtgacgccggatgatgcacag
ctcaccgccgccatcgacaaggcgctggccgctgccgccacgcattga

DBGET integrated database retrieval system