KEGG   Stenotrophomonas maltophilia R551-3: Smal_2651Help
Entry
Smal_2651         CDS       T00733                                 

Definition
(GenBank) Phospholipase A(1)
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
smt00564  Glycerophospholipid metabolism
smt00565  Ether lipid metabolism
smt00590  Arachidonic acid metabolism
smt00591  Linoleic acid metabolism
smt00592  alpha-Linolenic acid metabolism
smt01100  Metabolic pathways
smt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Smal_2651
   00565 Ether lipid metabolism
    Smal_2651
   00590 Arachidonic acid metabolism
    Smal_2651
   00591 Linoleic acid metabolism
    Smal_2651
   00592 alpha-Linolenic acid metabolism
    Smal_2651
Enzymes [BR:smt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Smal_2651
    3.1.1.32  phospholipase A1
     Smal_2651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1 VasI
Motif
Other DBs
NCBI-ProteinID: ACF52351
JGI: Smal2651
UniProt: B4SPT1
Position
2960747..2961901
Genome map
AA seq 384 aa AA seqDB search
MTLPPLLPRLAPLALALASAPLAAQEFAPGTDTSPAACAAITTDAARLACYDRLFAHTPQ
ATAAADAAAEAAAQARREERQTARVSQGEEKLRERVSDLFRPATPDSALANAGRGSLLDS
RWELAEDSKLGPFQLRAYKPVYLLPAFWTSDRNTTPHSPNPANTVTTPQVLDSAELKFQI
SFKTKIAENLFGDNGDIWAGYTQSSRWQAYNGEDSRPFRETNYEPEVMMVFRNGYSIGGW
RGRMTGIALNHQSNGRADPLSRSWNRVMLNIGLDRENWALVLRPWYRIPETRSDDNNPDI
EDYMGRGDATLTWNRNGHEVSLMARHSLRTGSRSHGALQLDYGFPISNLLRGHVQIFDGY
GESLIDYNHKATYVGVGVSLLEWF
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaccctccccccgctgcttccccgccttgcgccgttggcgctggccctggccagtgct
ccgctggccgcgcaggaattcgcgcccggcaccgacacctcgccggctgcctgtgccgcc
atcaccaccgacgcggcacgcctggcctgctatgaccgcctgttcgcacacaccccgcag
gctaccgctgcggccgacgccgctgccgaggcggccgcgcaggcccgtcgcgaagagcgc
cagactgcgcgtgtgagccagggcgaggagaagctgcgcgaacgtgtcagcgacctgttc
cgtccggcaacaccggacagcgcactggccaacgccggccgcggttcgctgctggacagc
cgctgggaactggccgaagactccaaactgggcccgttccagctgcgtgcgtacaagccg
gtgtacctgctgcccgcgttctggaccagcgaccgcaacaccacgccgcattcgccgaac
ccggccaacacggtcaccacgccgcaggtgctcgacagtgccgagctgaagttccagatc
agcttcaagaccaagatcgccgagaacctgttcggcgacaacggcgacatctgggccggc
tacacccagagctcgcgctggcaggcctacaacggcgaggattcgcgcccgttccgcgaa
accaactacgagccggaagtgatgatggtgttccgcaacggctactcgatcggtggctgg
cgtgggcgcatgaccggcatcgcgctgaatcaccagtccaacggccgtgccgacccactg
tcgcgcagctggaaccgggtgatgctcaacatcggcctggaccgcgagaactgggcgctg
gtgctgcgcccgtggtaccgcattcccgagacccgcagcgacgacaacaatccggacatc
gaggactacatgggccgcggtgatgcgaccctgacctggaaccgcaacggccacgaagtc
tcgttgatggcacgccattcgctgcgtaccggcagccgctcacacggtgccctgcagctg
gattacggcttcccgatcagcaacctgctgcgcggccacgtgcagatcttcgacggctac
ggcgaaagcctgatcgactacaaccacaaggccacctacgtgggcgtgggcgtgtccctg
ctggagtggttctga

DBGET integrated database retrieval system