KEGG   Stenotrophomonas maltophilia R551-3: Smal_2651Help
Entry
Smal_2651         CDS       T00733                                 

Definition
phospholipase A(1) (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:smt00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:smt00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:smt00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:smt00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:smt00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2960747..2961901
Genome map
AA seq 384 aa AA seqDB search
MTLPPLLPRLAPLALALASAPLAAQEFAPGTDTSPAACAAITTDAARLACYDRLFAHTPQ
ATAAADAAAEAAAQARREERQTARVSQGEEKLRERVSDLFRPATPDSALANAGRGSLLDS
RWELAEDSKLGPFQLRAYKPVYLLPAFWTSDRNTTPHSPNPANTVTTPQVLDSAELKFQI
SFKTKIAENLFGDNGDIWAGYTQSSRWQAYNGEDSRPFRETNYEPEVMMVFRNGYSIGGW
RGRMTGIALNHQSNGRADPLSRSWNRVMLNIGLDRENWALVLRPWYRIPETRSDDNNPDI
EDYMGRGDATLTWNRNGHEVSLMARHSLRTGSRSHGALQLDYGFPISNLLRGHVQIFDGY
GESLIDYNHKATYVGVGVSLLEWF
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaccctccccccgctgcttccccgccttgcgccgttggcgctggccctggccagtgct
ccgctggccgcgcaggaattcgcgcccggcaccgacacctcgccggctgcctgtgccgcc
atcaccaccgacgcggcacgcctggcctgctatgaccgcctgttcgcacacaccccgcag
gctaccgctgcggccgacgccgctgccgaggcggccgcgcaggcccgtcgcgaagagcgc
cagactgcgcgtgtgagccagggcgaggagaagctgcgcgaacgtgtcagcgacctgttc
cgtccggcaacaccggacagcgcactggccaacgccggccgcggttcgctgctggacagc
cgctgggaactggccgaagactccaaactgggcccgttccagctgcgtgcgtacaagccg
gtgtacctgctgcccgcgttctggaccagcgaccgcaacaccacgccgcattcgccgaac
ccggccaacacggtcaccacgccgcaggtgctcgacagtgccgagctgaagttccagatc
agcttcaagaccaagatcgccgagaacctgttcggcgacaacggcgacatctgggccggc
tacacccagagctcgcgctggcaggcctacaacggcgaggattcgcgcccgttccgcgaa
accaactacgagccggaagtgatgatggtgttccgcaacggctactcgatcggtggctgg
cgtgggcgcatgaccggcatcgcgctgaatcaccagtccaacggccgtgccgacccactg
tcgcgcagctggaaccgggtgatgctcaacatcggcctggaccgcgagaactgggcgctg
gtgctgcgcccgtggtaccgcattcccgagacccgcagcgacgacaacaatccggacatc
gaggactacatgggccgcggtgatgcgaccctgacctggaaccgcaacggccacgaagtc
tcgttgatggcacgccattcgctgcgtaccggcagccgctcacacggtgccctgcagctg
gattacggcttcccgatcagcaacctgctgcgcggccacgtgcagatcttcgacggctac
ggcgaaagcctgatcgactacaaccacaaggccacctacgtgggcgtgggcgtgtccctg
ctggagtggttctga

DBGET integrated database retrieval system