KEGG   Stenotrophomonas maltophilia R551-3: Smal_2890Help
Entry
Smal_2890         CDS       T00733                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Smal_2890
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Smal_2890
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Smal_2890
Enzymes [BR:smt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Smal_2890
Exosome [BR:smt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Smal_2890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3221842..3223548
Genome map
AA seq 568 aa AA seqDB search
MRRSVSLLAACATTLLLGACASTTPASAPAGLKVAVDPVAHPAGETPQWWYRSGAAQAAA
NGAMSGKAKNVILFLGDGMSLTTVAASRIYEGQQKGGSGEENLLSWERFPATAFSKTYNT
DSQTPDSAGTMTAITTGVKTHMGAIGVSAGTRTDCADSLSKGLLTWLQLADSAGLATGVV
STARLTHATPAATYAHSPERNWENDTDLTEAAKAAGCKDIAQQLLSTSRYGRGPLVALGG
GRGEFTTVEERDPEYDDKVGQRLDGRSLVQEWQQAHPQGAYVWNSKQLAAATNAPAILGL
FEPDHMRYEYERPQDPGGEPSLAELTAAAIKNLAKHQEGYVLMIEGARIDHANHSGNAYR
ALTETVALSDAVRVANELTSADDTLIIVTADHSHTLNFVGYPARGNPILGKVKDKGGEDG
AGKLDYALDGTGQPYTTLSYANGPGHTGSSNQQPAGTKRYPHNPSTFEPANGRPNLREVD
TEHPDYMQEALVPMKSESHGGEDVGIWARGPGSKAIRGTLEQNAIYHMIVQATPALRERL
CQAGTCDDKGVPVQLPAPTVFERKAEAK
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgttccgtctccctgttggccgcctgcgccaccaccctgctgctgggcgcctgc
gccagcaccacccccgcgtccgccccggccggcctgaaggtcgccgtcgatcctgtcgcc
catccggccggcgagaccccgcagtggtggtaccgcagcggcgccgcccaggcggcagcc
aacggcgcgatgtccggcaaggccaaaaacgtcatcctgttcctcggcgacggcatgagc
ctgaccaccgtagccgcctcgcgcatctacgaaggccagcagaagggcggctcgggcgag
gagaacctgctgtcctgggagcgcttcccggccacggccttcagcaagacctacaacacc
gattcgcagaccccggattcggccggcaccatgaccgccatcaccaccggcgtgaagacc
cacatgggcgcgatcggcgtcagcgccggcacccgcaccgactgcgccgacagcctgtcc
aagggactgctgacctggctgcagctggccgacagcgccggcctggccaccggcgtggtg
tccaccgcgcgcctgacccatgccactccggccgccacctacgcgcactcgcccgagcgc
aactgggaaaacgacaccgacctgaccgaagcggccaaggcggccggctgcaaggacatc
gcccagcagctgctgtcgacctcgcgctatggccgtggcccgctggtcgcccttggcggt
ggccgtggtgagttcaccaccgtggaagagcgcgatcccgagtacgacgacaaggtcggc
cagcgcctggacggccgcagtctggtgcaggagtggcagcaggcgcacccgcagggtgcc
tacgtgtggaacagcaagcagctggccgccgccaccaacgcgccggccatccttggcctg
ttcgagccggaccacatgcgctacgagtacgagcgcccgcaggatccgggcggtgagccg
agcctggccgaactgacggcggcagccatcaagaacctggccaagcaccaggaaggctac
gtgctgatgatcgaaggcgcgcgcatcgaccacgccaaccacagcggcaacgcctaccgg
gcgctgaccgagaccgtggcgctgtccgacgccgtgcgcgtggccaacgaactgacttcg
gccgatgacaccctgatcattgtcaccgccgaccactcgcacaccctgaacttcgtcggc
tacccggcgcgcggcaacccgatcctgggcaaggtgaaggacaagggcggcgaagacggc
gccggcaagctggactacgcgctggacggcaccggccagccctacaccacgctgagctac
gccaacggcccgggccacaccggcagcagcaaccagcagccggctggcaccaaacgctat
ccgcacaatcccagcacgttcgagccggccaatggccgcccgaacctgcgcgaggtcgat
accgagcaccccgattacatgcaggaagcgctggtaccgatgaagtccgaatcgcacggt
ggcgaggacgtcggcatctgggcccgcggccccggcagcaaggcgatccgcggcacgctg
gaacagaacgcgatctaccacatgatcgtgcaggccaccccggccctgcgcgagcgcctg
tgccaggccggcacctgcgatgacaagggcgtgccggtgcagttgccggcgccgaccgtc
ttcgagcgcaaggccgaggccaagtga

DBGET integrated database retrieval system