KEGG   Stenotrophomonas maltophilia R551-3: Smal_2982Help
Entry
Smal_2982         CDS       T00733                                 

Definition
NAD-binding 3-hydroxyacyl-CoA dehydrogenase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smal_2982
   01212 Fatty acid metabolism
    Smal_2982
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Smal_2982
   00650 Butanoate metabolism
    Smal_2982
  Lipid metabolism
   00071 Fatty acid degradation
    Smal_2982
   01040 Biosynthesis of unsaturated fatty acids
    Smal_2982
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Smal_2982
   00310 Lysine degradation
    Smal_2982
   00380 Tryptophan metabolism
    Smal_2982
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Smal_2982
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Smal_2982
   00281 Geraniol degradation
    Smal_2982
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Smal_2982
Enzymes [BR:smt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Smal_2982
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Smal_2982
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Smal_2982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3320147..3322210
Genome map
AA seq 687 aa AA seqDB search
MLSGFDGLRFSHWLPEIRDDGVVVLSLDRQDSSVNAMSQDVLLELGDLLERIAMDPPKGV
VIQSLKKAGFIAGADLKEFQEFDRRGTVNDAIRRGQSTYQKLAELPCPTVAAIHGHCLGG
GTELALACRYRVASNDSSTRIGLPETQLGIFPGWGGSARLPQLVGAPAAMDMMLTGRTLS
ASAARGIGLVDKVVAPAVVLDTAVALALSGTTRPFKQRATAWATNTWLARTLLAPQMVKQ
VARKAKKDQYPAPYALISTWQRSGGKPVQARLDAERRAVVKLASTPTARNLIRIFFLTER
LKGLGGGDSGIRHVHVVGAGVMGGDIAAWAAYKGFEVTLQDREQRFIDPAMERAQALFAK
KVRDESKRPAVAARLRADLEGNGVAEADLVIEAIIENPEAKRALYQTLEPKMKQDALLTT
NTSSIPLLELRDHIQRPAQFAGLHYFNPVAQMPLVEIIHHDGMAPETERRLAAFCKALGK
FPVPVAGSPGFLVNRVLFPYMLEAATAYAEGIPGPVIDKAAVKFGMPMGPIELIDTVGLD
VAAGVGRELAPFLGLQIPAALQTVEPDKRGKKDGQGIYTWENGRAKKPDVASDYQAPADL
EDRLILPLLNEAVACLHEGVVADSDLLDAGVIFGTGFAPFRGGPIQHIRAVGADAIVERL
KALQQRHGDRFAPRPGWDNPVLREPVV
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgctctcaggcttcgatggtctccgcttcagccactggctccccgagatccgcgacgac
ggcgtggtggtcctctccctggatcgtcaggacagcagcgtcaacgcaatgtcgcaggac
gtgctgctggaactgggcgacctgcttgagcgcatcgccatggacccgcccaagggcgtg
gtgatccagtccctgaagaaggccggcttcatcgccggtgccgacctgaaggaattccag
gaattcgaccgccgcggcaccgtgaacgatgccatccgccgtggccagtccacctaccag
aagctggccgagctgccctgcccgaccgtggcggcgatccatggccactgcctgggcggc
ggcaccgagctggcgctggcctgccgctaccgtgtggcttcgaatgacagttcgacccgc
atcggcctgccggaaacccagctgggcattttcccgggctggggcggcagcgcgcgcctg
ccgcagctggtgggcgcaccggcggcgatggacatgatgctgaccggccgcaccctgtca
gcctcggctgcacgtggcatcggcctggtcgacaaggtggtggcaccggcggtggtgctc
gacacggccgtagcgctggcgctgtccggcaccacccgcccgttcaagcagcgcgcgacg
gcatgggcgaccaacacctggctggcacgcacgctgctggcgccgcagatggtcaagcag
gtcgcacgcaaggcgaagaaggaccagtaccccgcgccgtatgcgctgatcagcacctgg
cagcgcagcggtggcaagccggtgcaggcacgcctggatgccgaacgtcgcgccgtggtg
aaactggccagcacccccaccgcgcgcaacctgatccgcatcttcttccttaccgagcgc
ctgaagggcctgggtggtggtgattcgggcatccgccacgtgcacgtggtcggtgccggt
gtgatgggcggcgatattgctgcatgggccgcctacaagggcttcgaagtgactctgcag
gaccgtgagcagcgcttcatcgacccggccatggaacgcgcccaagcgctgttcgccaag
aaagtgcgcgacgaaagcaagcgtccggcggtggccgcgcgcctgcgggccgacctggaa
ggcaacggcgtggctgaagccgacctggtgatcgaagccatcatcgagaacccggaagcc
aagcgtgcgctgtaccagacgctggaaccgaagatgaagcaggacgcactgctgaccacc
aatacttcgtcgattccgctgctggaactgcgcgaccacatccagcgcccggcgcagttc
gccggcctgcactacttcaacccggtggcgcagatgccgctggtggaaatcatccatcac
gacggcatggcgcctgaaaccgagcgtcgactggccgcgttctgcaaggcactgggcaag
ttccccgtgccggtggccggcagcccgggcttcctggtcaaccgcgtgctgttcccgtac
atgctggaagccgccaccgcctatgccgaaggcatcccgggcccggtgatcgacaaggcc
gctgtgaagttcggcatgccgatgggcccgatcgaactgatcgacacggtgggcctggac
gtggccgctggcgttggccgcgaactggcaccgttcctcggcctgcagattccggccgcg
ctgcagacggtggaaccggacaagcgcggcaagaaggatggccagggcatctatacctgg
gaaaacggccgtgcgaagaagccggacgtggccagcgattaccaggcaccggccgatctg
gaagaccgcctgatcctgccgctgttgaacgaggcagtggcctgcctgcacgaaggcgtg
gtggcggattcggacctgctggatgccggcgtgatcttcggtactggcttcgcaccgttc
cgtggcggcccgatccagcacatccgcgcggtgggtgccgatgcaatcgtggagcggctg
aaggcactgcagcagcgccacggcgatcgtttcgccccgcgcccgggctgggacaacccc
gtcctgcgtgaaccggtggtgtga

DBGET integrated database retrieval system