KEGG   Stenotrophomonas maltophilia R551-3: Smal_3425Help
Entry
Smal_3425         CDS       T00733                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smal_3425
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smal_3425
   00052 Galactose metabolism
    Smal_3425
   00500 Starch and sucrose metabolism
    Smal_3425
   00520 Amino sugar and nucleotide sugar metabolism
    Smal_3425
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Smal_3425
   00524 Butirosin and neomycin biosynthesis
    Smal_3425
Enzymes [BR:smt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Smal_3425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3851174..3852193
Genome map
AA seq 339 aa AA seqDB search
MTASHPAPAHVLSRVAPSFLAADVGGTHVRVARVQASGDAAHPVQVLEYRKYRNADHAGL
SAILSDFLGEGSRPTHCVVASAGYAREDGTVITANLPWPLSARQVEADVGLQRVYIVNDF
EAVAYAAAQVDASGVLHLCGPDTAARGPTLVVGPGTGLGAALWIPTAHGPVVLPTEAGQP
TLAASTELEMAIVRHMQRDRAHVSIEHAISGPGLMNLYRAVCALQDQAPTLASPDAVTAA
AMADTDAHARQALDVFCGLLGSTIGDMALFYGAHGGVYLAGGILPQIREYLRGSTFVERY
LQKGPMGEALARIPVKVVEHGQLGVVGAASWYLQQQSAA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccagccaccccgccccggcccatgtcctgtcccgagtcgcgccctcgttcctg
gccgccgacgtcggtggcacccatgtgcgcgttgcccgggtccaggccagcggtgacgct
gcccatccggtgcaggtgctggagtaccgcaagtaccgcaacgccgaccatgccggcctc
agcgcgatcctgtccgacttcctcggcgaaggctcgcggcccacgcactgcgtggtcgcc
agcgccggctatgcccgcgaggatggcacggtgatcactgccaacctgccatggccgctg
tcggcgcgccaggtggaggccgacgtcggcctgcagcgggtctacatcgtcaacgacttc
gaagccgtggcctacgccgccgcgcaggttgacgccagtggcgtgctgcacctgtgcggg
ccggacaccgccgcccgaggcccgaccctggtggtcggccccggcacgggtctgggtgcc
gcgctgtggattcccaccgcgcacggaccggttgtgctgcccaccgaagccggccagccc
acgctggcggccagcaccgaactggaaatggccatcgtccgccacatgcagcgcgaccgc
gcgcacgtgtcgatcgaacatgcgatctccggcccgggcctgatgaacctgtaccgcgcg
gtgtgtgcgctgcaggaccaggcgccgaccctggccagccccgacgcggtcacagccgcg
gccatggccgataccgatgcgcacgcgcgccaggcgctggatgtgttctgcggcctgctc
ggcagcaccatcggcgacatggccctgttctacggcgcccatggcggcgtctacctggcc
ggcggcatcctgccgcagatccgcgaatacctgcgcggcagcactttcgtcgaacgctac
ctgcagaaggggccgatgggcgaagcgctggcacgcatcccggtgaaggtggtcgaacac
ggccagctgggcgtggtcggcgctgccagctggtacctgcagcagcagtccgccgcctga

DBGET integrated database retrieval system