KEGG   Stenotrophomonas maltophilia R551-3: Smal_3427Help
Entry
Smal_3427         CDS       T00733                                 

Definition
(GenBank) Beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
smt00511  Other glycan degradation
smt00520  Amino sugar and nucleotide sugar metabolism
smt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Smal_3427
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Smal_3427
Enzymes [BR:smt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Smal_3427
Chaperones and folding catalysts [BR:smt03110]
 Intramolecular chaperones
  Others
   Smal_3427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b CHB_HEX_C_1 CBM_6 Fn3_assoc Urocanase_N
Motif
Other DBs
NCBI-ProteinID: ACF53126
JGI: Smal3427
UniProt: B4SJ01
Position
3855157..3857514
Genome map
AA seq 785 aa AA seqDB search
MVKPSRARMRSAVLLGSLLALLPALPALAADPTPAAEAPGPQLRAGSLMLIPAPSNVQAG
QGSGITVRADTVLQAEGEVAQRVAAQFADLLARSGGPRLVLAKGKAAAKTGSIRFQIVPT
FRDSGESYTLESTAQGVVIQAGNETGLFYGATTLAQLATGGSNGVLPAVQIQDAPRFSWR
GFMLDSARHFQSLDEIKRVLDAMAAHKLNTFHWHLTDDQGWRMEIKRYPKLTEVGSCRLP
AGDGGIDPVSGQEHPYCGFYTQEQIREVIAYAAKLHIQVIPEIDVPGHATAAIAAYPELG
TIDTPLKPLSEWGVFPNLFNVEDSTVTFLENVLEEVIELFPAKYVHVGGDEAVKDQWEAS
KQVQQRMHALGIKDEMAMQSHIIKRLETFLEEHDRRLIGWDEILEGGLPPQATVMSWQGT
EGGLAAASAGHDVIMSPVGYLYLDYLQTASPNEPPGRPTQVNLGKLYNFEPVPAELAADK
RGHILGLQANMFTEHTRSYARLQHNLFPRLAAVAETGWSTPERRDFRDFLARLPAQLQRY
RAWGLAYAQTPFEVGVDYTDSRAANTVTLSLANPLGYEVRYSTDGQPVTAQSPLYQQPLT
TQLPANVQAAAFYQGQMLAARPTVADFSAQSLLSRRSDELLSCVGKKGLVLRLEDDGPRE
GNRAVFNVDIFQPCWRWPQAQLDGIGSVEVRAGRIPYYFQLAHDEPKRRFEKAKRAHGEM
QVRRGDCSGRVLAEVPLPAKPDADGFVTLRATLPKGTQGSADLCINFTGDTRPAMWVLDE
VTLGK
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagccttcccgcgcccggatgcgcagcgcagtgctgctgggcagcctgctcgct
ctgctgccggcactgccggcactcgccgccgatcccacgcctgccgctgaagcacccggc
ccgcagctgcgcgccggcagcctgatgctgattcccgcccccagcaatgtgcaggccggc
cagggcagcggcatcaccgttcgcgccgataccgtgctgcaggccgaaggcgaagtcgcg
cagcgcgtcgccgcccagttcgccgacctgctggcccgcagtggtggcccgcgcctggtc
ctggccaagggcaaggctgcagccaagaccggcagcatccgcttccagatcgtgcccacc
ttccgcgacagcggcgaaagctacacgctggagagcaccgcgcagggcgtggtgatccag
gccggcaacgagacaggtcttttctacggcgcgaccaccctggcccagctcgccaccggc
ggcagcaacggcgtgctgccggcagtgcagatccaggacgcgccgcgcttcagctggcgc
ggcttcatgctcgactcggcgcggcatttccagagcctggacgagatcaagcgcgtgctc
gatgcaatggccgcgcacaagctcaataccttccattggcatctcaccgatgaccagggc
tggcgcatggagatcaagcgctacccgaagctgaccgaagtgggcagctgccgcctgccg
gccggcgacggtggcatcgatccggtcagtggccaggaacatccgtactgcggcttctac
acgcaggagcagatccgcgaggtgatcgcctacgccgccaaactgcatatccaggtgatt
ccggaaatcgacgtgcccggccatgcgaccgctgcgatcgccgcttatcccgaactgggc
accatcgatacaccactgaagccgctcagcgaatggggcgtgttccccaacctgttcaac
gtcgaagacagcacggtgaccttcctcgagaacgtgctggaagaagtgatcgaactgttc
cccgccaagtacgtgcacgtgggtggcgacgaggcggtcaaggaccagtgggaagcttcg
aagcaggtgcagcagcgcatgcatgcgctgggcatcaaggatgaaatggccatgcagagc
cacatcatcaagcgcctggagacgttcctggaggagcacgaccggcgcctgatcggctgg
gacgagatcctcgaaggcgggctgccgccgcaggccacggtgatgtcatggcagggcacc
gaaggtggcctggctgcagccagtgccgggcatgacgtgatcatgtcgccggtcggctac
ctgtacctggactacctgcagaccgcctcgccgaacgagccgccgggtcgtccgacccag
gtcaacctcggcaaactctacaacttcgaaccggtgccggccgagctggcggccgacaag
cgcgggcacatcctcggcctgcaggccaacatgttcaccgagcacacgcgcagctatgcg
cgcctgcagcacaacctgttcccgcgcctggccgctgtggccgagaccggttggagcacg
ccggagcgtcgtgatttccgcgatttcctcgcacgcctgccggcacagctgcagcgctac
cgtgcctggggcctggcctacgcgcagaccccgttcgaagtgggcgtggactacaccgac
agccgcgcggccaacacggtgactctgtcgctggccaacccgctgggctatgaagtgcgc
tacagcaccgacggacagccagtgaccgcgcagtcgccgctgtaccagcagccgctgacc
acgcagctgcccgccaacgtgcaggccgccgcgttctaccagggccagatgctggccgcg
aggccgacggtcgcggacttcagcgcacaatcgctgctcagccgccgcagcgatgaactg
ctcagctgcgtgggcaagaaggggttggtgctgcgcctggaagacgatggcccgcgcgaa
ggcaaccgtgcggtattcaacgtcgacatcttccagccgtgctggcgctggccgcaggcg
cagctggacggcatcggcagcgtggaagtgcgtgccggccgcattccgtactacttccag
ctggcccacgacgagcccaagcgccgcttcgagaaggccaagcgtgcgcacggcgagatg
caggtgcgtcgcggagactgcagcggcagggtgctggccgaagtcccattgccggccaag
ccggatgccgatggcttcgtgaccctgcgcgccacgctgccgaaggggacccagggcagc
gctgacctgtgcatcaacttcaccggcgatacgcgcccggcgatgtgggtgctggatgag
gtcacgctggggaagtaa

DBGET integrated database retrieval system