KEGG   Stenotrophomonas maltophilia R551-3: Smal_3431Help
Entry
Smal_3431         CDS       T00733                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
smt00790  Folate biosynthesis
smt01100  Metabolic pathways
Module
smt_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Smal_3431
Enzymes [BR:smt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Smal_3431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK CT_C_D
Motif
Other DBs
NCBI-ProteinID: ACF53130
JGI: Smal3431
UniProt: B4SJ05
Position
complement(3860146..3860667)
Genome map
AA seq 173 aa AA seqDB search
MSTPPKCRHLNRMTTVLLSLGSNVQPRRYLHAAVTALRERFGALQVSPAYRTAAVGFDGP
AFLNNAVAIETDLPLQELDNWLHALEDAQGRDRSGPRFSDRTLDIDVVFYGDLVVEGPGH
LRIPRPELKHAFVLKPLADIAPEFVDPVSGQDLATLWRAHRQFGEAFEVVDLE
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgccccccaagtgccgtcacctgaaccgcatgaccaccgtgctcctgagcctg
ggcagcaacgtccagccccgccgctacctccacgccgcggtgacggccctgcgcgagcgc
ttcggcgcgctgcaggtgtcacccgcctaccgtactgctgcggtcggcttcgatggcccg
gccttcctcaacaatgcggtggcgatcgagaccgacctgccactgcaggaactggacaac
tggctgcatgcgctggaagacgcgcaagggcgtgaccgcagtggcccgcgcttttccgac
cggaccctggacatcgatgtggtgttctacggcgacctggtggtggagggccccggccac
ctgcgcatccctcgcccggagctgaagcatgccttcgtactgaagccgctggcggacatc
gcgccggagttcgttgacccggtcagcggccaggacctggccacgctgtggcgtgcgcac
aggcagtttggcgaagcgttcgaggtcgtggacctcgaatga

DBGET integrated database retrieval system