KEGG   Stenotrophomonas maltophilia R551-3: Smal_3431Help
Entry
Smal_3431         CDS       T00733                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:smt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3860146..3860667)
Genome map
AA seq 173 aa AA seqDB search
MSTPPKCRHLNRMTTVLLSLGSNVQPRRYLHAAVTALRERFGALQVSPAYRTAAVGFDGP
AFLNNAVAIETDLPLQELDNWLHALEDAQGRDRSGPRFSDRTLDIDVVFYGDLVVEGPGH
LRIPRPELKHAFVLKPLADIAPEFVDPVSGQDLATLWRAHRQFGEAFEVVDLE
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgccccccaagtgccgtcacctgaaccgcatgaccaccgtgctcctgagcctg
ggcagcaacgtccagccccgccgctacctccacgccgcggtgacggccctgcgcgagcgc
ttcggcgcgctgcaggtgtcacccgcctaccgtactgctgcggtcggcttcgatggcccg
gccttcctcaacaatgcggtggcgatcgagaccgacctgccactgcaggaactggacaac
tggctgcatgcgctggaagacgcgcaagggcgtgaccgcagtggcccgcgcttttccgac
cggaccctggacatcgatgtggtgttctacggcgacctggtggtggagggccccggccac
ctgcgcatccctcgcccggagctgaagcatgccttcgtactgaagccgctggcggacatc
gcgccggagttcgttgacccggtcagcggccaggacctggccacgctgtggcgtgcgcac
aggcagtttggcgaagcgttcgaggtcgtggacctcgaatga

DBGET integrated database retrieval system