KEGG   Stenotrophomonas maltophilia R551-3: Smal_3638Help
Entry
Smal_3638         CDS       T00733                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Smal_3638
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Smal_3638
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Smal_3638
Enzymes [BR:smt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Smal_3638
Exosome [BR:smt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Smal_3638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4099900..4101447)
Genome map
AA seq 515 aa AA seqDB search
MTRPVARRWLCPSILAVLATLSGCQPNLRADAVPPAEARPHNVIVMINDGAGWGTWDAAA
YWQYGSREGAPYADFPQRLAVATFPLNASSQPTRDNAQTLGYDAAKAWDDSPVPAQDLPF
AGYQYLAAVATDSAAAGTALSSGIKTYNNAINYNNDGNAVEFNTLRAKRLGMATGVVTSV
PFAHATPAAFAAQNESRNNYHAIAHQMLAQGHMDLVMGTGGPGYSVDGRACGGDAGAAKA
EGCANPWEWVSQQDWQQLQAGTSIGGNPAGPWRLIRSKEEFAALAQGRLPADRPLIGVPR
VANTLQQARQLQVVGKDATTPSGVRKIDSVPDLASMTRGALRFLQQRSSKGLFLMVEGGA
TDWAAHTSACGTEWHYGQCSDQPQYGRLIEETVEFNDAVTAVIEWIERNGGWEHTLLIVT
TDHDNSMPMGPDAQSVAFEPVRNNGRGHMPGMSFRPTGNHSNALVPLWAKGAGAELLGKR
VRGVDAGYRQHVRWNDGSYIDNTDVAAAVQEALQR
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgacccgacccgttgcgcgacgttggctgtgcccgtcgatcctggccgtactggccacc
ctgagcggctgccagccgaatctgcgcgccgatgctgttccccctgccgaagcccgcccg
cacaacgtgatcgtgatgatcaatgacggtgctggctggggtacctgggatgcggcggcc
tactggcagtacggcagccgcgaaggcgcaccgtatgcggactttccgcagcgcctggcg
gtggcgaccttcccgttgaacgccagcagccagccgacccgcgacaacgcacagaccctg
ggctacgacgcggccaaagcgtgggatgactccccggtgccggcgcaggacctgccgttc
gccggctaccagtacctggccgcggtcgccaccgacagtgcagcggcgggcacggcgttg
tcctcgggcatcaagacctacaacaacgccatcaactacaacaatgacggcaacgcggtc
gagttcaacacgctgcgtgccaagcgcctgggcatggccaccggcgtggtcacctcggtg
ccgttcgcacatgccacgccggccgcgttcgctgcgcagaacgagtcgcgcaacaactac
cacgccatcgcccatcagatgctggcgcagggccacatggacctggtgatgggcaccggt
ggtcccggctacagcgttgatggccgtgcctgcggcggggatgcgggtgcggcgaaggcc
gagggctgcgcgaacccgtgggaatgggtgtcgcagcaggattggcagcagctgcaagcc
ggcacctccattggcggcaatccggcgggaccgtggcgcctgatccgcagcaaggaggaa
ttcgctgcactggcgcagggacggctgccggctgaccggccgctgatcggcgtgccgcgc
gtggccaacacgctgcagcaggcgcggcagctgcaggtggtgggcaaggatgcgaccacg
ccttccggtgtgaggaagatcgacagcgtgccggatcttgcgagcatgacccgcggtgcg
ttgcggttcctgcagcagcgttcatccaagggcctgttcctgatggttgaaggtggcgct
accgactgggccgcgcacaccagcgcctgtggcaccgaatggcattacgggcagtgcagc
gaccagccgcagtacggccggctgatcgaagaaaccgtagagttcaacgacgcggtgacg
gcagtgatcgagtggatcgaacgcaacggtggctgggaacacaccctgctgatcgtcacc
accgaccacgacaacagcatgccgatgggcccggatgcacagagcgtggccttcgaaccg
gtgcgcaacaacggccgcgggcacatgccaggaatgagcttccggcccaccggcaaccac
tccaatgcactggtgccgctgtgggccaagggcgcaggtgcggaactgctgggcaagcgc
gtgcgtggtgtcgatgcgggctaccgccagcatgtgcgctggaatgacggcagttacatc
gacaacaccgacgtggctgcggcggtgcaggaagcgctgcagcgctag

DBGET integrated database retrieval system