KEGG   Stenotrophomonas maltophilia R551-3: Smal_3749Help
Entry
Smal_3749         CDS       T00733                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smal_3749
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smal_3749
   00020 Citrate cycle (TCA cycle)
    Smal_3749
   00620 Pyruvate metabolism
    Smal_3749
Enzymes [BR:smt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Smal_3749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4216780..4218168
Genome map
AA seq 462 aa AA seqDB search
MSQTKNFNLPDLGEGLPDATIVEWFVKEGDVIKLDEPLVSMETAKAVVEVPSPFSGTVLK
LSGAAGDIIPTGSVLASFALDPNLPQRADGQDTGHSHGHAAPAAAPTPPPLPAAAAPVAA
EAAKPAAAERDDAGTVVGAMQSSNAVHAEQALAVGGVKAVPAVRATARKLGVDLSRVRAT
GADGAVTMADVKQAAADGSAKIGAAPAPAAAAAYAAPAPAQVSAPVQSEARTPLSAAGKP
MRTQPPGVVAKGQPEPLKGVRRNMARVMADAHSKVVPTTLNDDADIHAWLPGNDVTARLV
RSIVVAAQKVPAMNAWFDGEALTRTLHAQVDIGIAVDTDDGLFVPALRNADMLDARGIRE
GVNRLREQVESRSIAASELSGYTISLSNFGMFAGRYATPVVVPPCVAIVGAGRARHQMTP
VMGGVEAHKVIPLSVTFDHRAATGGEAARFLRAMMDDLALAS
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaccaagaacttcaacctgcccgacctgggcgaaggcctgccggacgcgacc
atcgtcgagtggttcgtcaaggaaggcgatgtgatcaagctggacgagccactggtctcg
atggagaccgccaaggccgtcgtcgaagtgccgtcgccgttctccggcacggtgctgaag
ctgtccggcgctgccggcgacatcatcccgaccggttcggtgctggccagcttcgcgctg
gacccgaacctgccgcagcgtgccgatggccaggacaccggccacagccacggtcatgca
gcgccggccgctgcaccgaccccgccgccgctgccggccgctgccgcaccggtggccgcc
gaagccgccaagcccgccgccgccgaacgtgatgacgccggtaccgtggtcggcgcgatg
cagagctccaacgccgtgcacgccgaacaggcgctggccgtcggtggcgtcaaggccgta
ccggccgtgcgtgccaccgcgcgcaagctgggcgtggacctgtcccgcgtacgcgccacc
ggcgccgatggcgcggtgaccatggccgacgtcaagcaggcggctgcggatggcagcgca
aagatcggtgccgctccggcgccggccgctgctgccgcctacgccgcgccggcaccggcg
caggtgtctgccccggtgcagagcgaagcgcgcaccccgctgtccgccgccggcaagccg
atgcgcacccagccgccgggcgtggtcgccaagggccagccggaaccgctgaagggcgtg
cgccgcaacatggcgcgggtgatggccgatgcgcacagcaaggtcgtgccgaccacgctg
aacgacgacgccgacatccacgcctggctgccgggcaacgacgtcaccgcgcgcctggtg
cgttcgatcgtggtcgccgcacagaaggtgccggcgatgaacgcctggttcgacggtgaa
gcactgacccgcaccctgcacgcccaggtcgacatcggcattgccgtggacaccgacgac
ggcctgtttgtgccggccctgcgcaatgccgacatgctcgacgcacgcggcatccgcgaa
ggcgtcaaccgcctgcgcgagcaggtggaatcgcgttcgatcgccgcctcggaactgagc
ggctacaccatctcgctgtccaacttcggcatgttcgccggccgctacgcgaccccggtc
gtggtgccgccatgcgtggccatcgtcggtgccggccgtgcccgccaccagatgaccccg
gtgatgggcggcgtggaagcgcacaaggtaatcccgctgtcggtcaccttcgaccaccgc
gcggccacgggtggtgaagcggcacgcttcctgcgcgcgatgatggacgatttggcgctg
gccagctga

  All links  
No link information was found.   
DBGET integrated database retrieval system