KEGG   Stenotrophomonas maltophilia R551-3: Smal_3749Help
Entry
Smal_3749         CDS       T00733                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
smt00010  Glycolysis / Gluconeogenesis
smt00020  Citrate cycle (TCA cycle)
smt00620  Pyruvate metabolism
smt01100  Metabolic pathways
smt01110  Biosynthesis of secondary metabolites
smt01120  Microbial metabolism in diverse environments
smt01130  Biosynthesis of antibiotics
smt01200  Carbon metabolism
Module
smt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smal_3749
   00020 Citrate cycle (TCA cycle)
    Smal_3749
   00620 Pyruvate metabolism
    Smal_3749
Enzymes [BR:smt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Smal_3749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ACF53448
JGI: Smal3749
UniProt: B4SM03
Position
4216780..4218168
Genome map
AA seq 462 aa AA seqDB search
MSQTKNFNLPDLGEGLPDATIVEWFVKEGDVIKLDEPLVSMETAKAVVEVPSPFSGTVLK
LSGAAGDIIPTGSVLASFALDPNLPQRADGQDTGHSHGHAAPAAAPTPPPLPAAAAPVAA
EAAKPAAAERDDAGTVVGAMQSSNAVHAEQALAVGGVKAVPAVRATARKLGVDLSRVRAT
GADGAVTMADVKQAAADGSAKIGAAPAPAAAAAYAAPAPAQVSAPVQSEARTPLSAAGKP
MRTQPPGVVAKGQPEPLKGVRRNMARVMADAHSKVVPTTLNDDADIHAWLPGNDVTARLV
RSIVVAAQKVPAMNAWFDGEALTRTLHAQVDIGIAVDTDDGLFVPALRNADMLDARGIRE
GVNRLREQVESRSIAASELSGYTISLSNFGMFAGRYATPVVVPPCVAIVGAGRARHQMTP
VMGGVEAHKVIPLSVTFDHRAATGGEAARFLRAMMDDLALAS
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaccaagaacttcaacctgcccgacctgggcgaaggcctgccggacgcgacc
atcgtcgagtggttcgtcaaggaaggcgatgtgatcaagctggacgagccactggtctcg
atggagaccgccaaggccgtcgtcgaagtgccgtcgccgttctccggcacggtgctgaag
ctgtccggcgctgccggcgacatcatcccgaccggttcggtgctggccagcttcgcgctg
gacccgaacctgccgcagcgtgccgatggccaggacaccggccacagccacggtcatgca
gcgccggccgctgcaccgaccccgccgccgctgccggccgctgccgcaccggtggccgcc
gaagccgccaagcccgccgccgccgaacgtgatgacgccggtaccgtggtcggcgcgatg
cagagctccaacgccgtgcacgccgaacaggcgctggccgtcggtggcgtcaaggccgta
ccggccgtgcgtgccaccgcgcgcaagctgggcgtggacctgtcccgcgtacgcgccacc
ggcgccgatggcgcggtgaccatggccgacgtcaagcaggcggctgcggatggcagcgca
aagatcggtgccgctccggcgccggccgctgctgccgcctacgccgcgccggcaccggcg
caggtgtctgccccggtgcagagcgaagcgcgcaccccgctgtccgccgccggcaagccg
atgcgcacccagccgccgggcgtggtcgccaagggccagccggaaccgctgaagggcgtg
cgccgcaacatggcgcgggtgatggccgatgcgcacagcaaggtcgtgccgaccacgctg
aacgacgacgccgacatccacgcctggctgccgggcaacgacgtcaccgcgcgcctggtg
cgttcgatcgtggtcgccgcacagaaggtgccggcgatgaacgcctggttcgacggtgaa
gcactgacccgcaccctgcacgcccaggtcgacatcggcattgccgtggacaccgacgac
ggcctgtttgtgccggccctgcgcaatgccgacatgctcgacgcacgcggcatccgcgaa
ggcgtcaaccgcctgcgcgagcaggtggaatcgcgttcgatcgccgcctcggaactgagc
ggctacaccatctcgctgtccaacttcggcatgttcgccggccgctacgcgaccccggtc
gtggtgccgccatgcgtggccatcgtcggtgccggccgtgcccgccaccagatgaccccg
gtgatgggcggcgtggaagcgcacaaggtaatcccgctgtcggtcaccttcgaccaccgc
gcggccacgggtggtgaagcggcacgcttcctgcgcgcgatgatggacgatttggcgctg
gccagctga

DBGET integrated database retrieval system