KEGG   Stenotrophomonas maltophilia R551-3: Smal_4006Help
Entry
Smal_4006         CDS       T00733                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
smt00790  Folate biosynthesis
smt01100  Metabolic pathways
Module
smt_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Smal_4006
Enzymes [BR:smt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Smal_4006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF XendoU PSII_Pbs27
Motif
Other DBs
NCBI-ProteinID: ACF53705
JGI: Smal4006
UniProt: B4SNT5
Position
complement(4528633..4529244)
Genome map
AA seq 203 aa AA seqDB search
MSKNNEKAAPQGDVTQDQAEDAVRTLLRWAGEDPSREGLLDTPRRVAEAYGDWFSGYRDD
PRAYMERTFEEVAGYDELIVLRDIEYESHCEHHMAPIIGRVHVGYLPAGKVVGISKLARV
VEAYARRFQVQEKMTAQIAQCIQDVLQPIGVGVVVEGAHECMTTRGIHKRGVSMVTSKML
GSFRDDARTRAEFLRFIEVGGKR
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaacaacgaaaaggccgccccgcagggcgacgtgacccaggaccaggccgag
gatgccgtgcgcaccctgctgcgctgggccggtgaggacccgtcccgtgaaggcctgctg
gataccccccgccgtgtcgccgaagcctatggcgactggttcagcggttaccgcgacgac
ccgcgcgcctacatggagcggaccttcgaggaagtggctggctacgacgaactgatcgtc
ctgcgcgacatcgagtacgaaagccactgcgaacaccacatggcgccgatcatcggccgc
gtgcatgtcggctacctgccggccggcaaggtggtgggcatcagcaagctggcccgcgtc
gtcgaagcctacgcccgccgtttccaggtgcaggagaagatgaccgcgcagatcgcccag
tgcatccaggatgtgctgcagccgatcggtgtcggcgtggtcgtcgaaggcgcccacgaa
tgcatgaccacccgcggcatccacaagcgcggcgtcagcatggttacctccaagatgctg
ggcagcttccgcgacgacgcgcgtacccgcgccgagttcctgcgtttcatcgaagtgggc
ggcaagcgctga

DBGET integrated database retrieval system