KEGG   Streptococcus mutans UA159: SMU_1004Help
Entry
SMU_1004          CDS       T00100                                 

Gene name
gtfB
Definition
glucosyltransferase-I
Orthology
K00689  
dextransucrase [EC:2.4.1.5]
Organism
smu  Streptococcus mutans UA159
Pathway
Starch and sucrose metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SMU_1004 (gtfB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SMU_1004 (gtfB)
Enzymes [BR:smu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.5  dextransucrase
     SMU_1004 (gtfB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
951112..955542
Genome map
AA seq 1476 aa AA seqDB search
MDKKVRYKLRKVKKRWVTVSVASAVMTLTTLSGGLVKADSNESKSQISNDSNTSVVTANE
ESNVTTEVTSKQEAASSQTNHTVTTISSSTSVVNPKEVVSNPYTVGETASNGEKLQNQTT
TVDKTSEAAANNISKQTTEADTDVIDDSNAANLQILEKLPNVKEIDGKYYYYDNNGKVRT
NFTLIADGKILHFDETGAYTDTSIDTVNKDIVTTRSNLYKKYNQVYDRSAQSFEHVDHYL
TAESWYRPKYILKDGKTWTQSTEKDFRPLLMTWWPSQETQRQYVNYMNAQLGINKTYDDT
SNQLQLNIAAATIQAKIEAKITTLKNTDWLRQTISAFVKTQSAWNSDSEKPFDDHLQNGA
VLYDNEGKLTPYANSNYRILNRTPTNQTGKKDPRYTADNTIGGYEFLLANDVDNSNPVVQ
AEQLNWLHFLMNFGNIYANDPDANFDSIRVDAVDNVDADLLQIAGDYLKAAKGIHKNDKA
ANDHLSILEAWSDNDTPYLHDDGDNMINMDNKLRLSLLFSLAKPLNQRSGMNPLITNSLV
NRTDDNAETAAVPSYSFIRAHDSEVQDLIRDIIKAEINPNVVGYSFTMEEIKKAFEIYNK
DLLATEKKYTHYNTALSYALLLTNKSSVPRVYYGDMFTDDGQYMAHKTINYEAIETLLKA
RIKYVSGGQAMRNQQVGNSEIITSVRYGKGALKATDTGDRTTRTSGVAVIEGNNPSLRLK
ASDRVVVNMGAAHKNQAYRPLLLTTDNGIKAYHSDQEAAGLVRYTNDRGELIFTAADIKG
YANPQVSGYLGVWVPVGAAADQDVRVAASTAPSTDGKSVHQNAALDSRVMFEGFSNFQAF
ATKKEEYTNVVIAKNVDKFAEWGVTDFEMAPQYVSSTDGSFLDSVIQNGYAFTDRYDLGI
SKPNKYGTADDLVKAIKALHSKGIKVMADWVPDQMYAFPEKEVVTATRVDKFGKPVEGSQ
IKSVLYVADSKSSGKDQQAKYGGAFLEELQAKYPELFARKQISTGVPMDPSVKIKQWSAK
YFNGTNILGRGAGYVLKDQATNTYFNISDNKEINFLPKTLLNQDSQVGFSYDGKGYVYYS
TSGYQAKNTFISEGDKWYYFDNNGYMVTGAQSINGVNYYFLSNGLQLRDAILKNEDGTYA
YYGNDGRRYENGYYQFMSGVWRHFNNGEMSVGLTVIDGQVQYFDEMGYQAKGKFVTTADG
KIRYFDKQSGNMYRNRFIENEEGKWLYLGEDGAAVTGSQTINGQHLYFRANGVQVKGEFV
TDRYGRISYYDSNSGDQIRNRFVRNAQGQWFYFDNNGYAVTGARTINGQHLYFRANGVQV
KGEFVTDRHGRISYYDGNSGDQIRNRFVRNAQGQWFYFDNNGYAVTGARTINGQHLYFRA
NGVQVKGEFVTDRYGRISYYDSNSGDQIRNRFVRNAQGQWFYFDNNGYAVTGARTINGQH
LYFRANGVQVKGEFVTDRYGRISYYDANSGERVRIN
NT seq 4431 nt NT seq  +upstreamnt  +downstreamnt
atggacaagaaagtgcgttataaactgcgcaaagttaaaaaaagatgggtgacagtatct
gttgcatctgctgtgatgactttaactacactttcgggtggcttggttaaagcagattct
aatgaatcgaaatcccaaatttctaatgattctaatactagtgttgttactgctaatgaa
gaatctaatgtaacaaccgaagtgacatctaagcaagaagctgctagtagtcaaactaat
catacagtaacgacaatcagtagctctacttcagtagttaatcccaaagaggttgtaagt
aatccttatactgttggggaaacagcttctaatggtgaaaagcttcaaaatcaaacaact
acagttgacaaaacttctgaagctgctgctaataatattagtaaacaaacaaccgaagct
gatacagatgttattgatgatagcaatgcagccaatctacaaatattggaaaaacttccc
aatgtaaaagaaattgatggtaagtattattattatgacaataacggcaaagttcgtact
aattttacattaattgctgatggcaaaattttacattttgatgaaactggcgcttatact
gatacatcaattgacactgtaaataaagatatcgtcacaacaagaagtaatctatacaaa
aaatataatcaagtttatgatcgctctgcacagagctttgagcatgttgatcattatttg
acagccgaaagttggtatcgtcctaagtacatcttgaaggatggcaaaacatggacacag
tcaacagaaaaagattttcgtcccttactgatgacatggtggccgagccaagaaacacag
cgtcaatatgttaactacatgaatgcacagcttggcattaacaagacttatgatgataca
agtaatcaattgcaattaaatattgcagctgcaactattcaagcaaaaattgaggccaaa
attacaactttaaagaatactgattggctgcgtcagactatttccgcatttgttaagaca
cagtcagcttggaacagtgacagcgaaaaaccgtttgatgatcatttacaaaatggagca
gtgctttacgataatgaaggaaaattaacgccttatgctaattccaactaccgtatctta
aatcgcaccccgaccaatcaaactgggaagaaggatccaagatatacagctgataacact
atcggcggttacgaattccttttggccaacgatgtggataattccaatcctgtcgtgcag
gccgaacaattgaactggctgcattttctcatgaactttggcaacatttatgccaatgat
ccggatgctaactttgattccattcgtgttgatgcggtggataatgtggatgctgacttg
ctccaaattgctggggattacctcaaagctgctaaggggatccataaaaatgataaggct
gctaatgatcatttgtctattttagaggcatggagtgacaacgacactccttaccttcat
gatgatggcgacaatatgattaatatggacaataagctgcgtttgtctctattattttca
ttagctaaacccttaaatcaacgttcaggcatgaatcctctgatcactaacagtttggtg
aatcgaactgatgataatgctgaaactgccgcagtcccttcttattccttcatccgtgcc
catgacagtgaagtgcaggatttgattcgtgatatcatcaaggcagaaatcaatcctaat
gttgtcgggtattcattcactatggaggaaatcaagaaggctttcgagatttacaacaaa
gacttattagctacagagaagaaatacacacactataatacggcactttcttatgccctg
cttttaaccaacaaatccagtgtgccgcgtgtctattatggggatatgtttacagatgac
gggcaatacatggctcataagacgatcaattacgaagccatcgaaaccctgcttaaagct
cgtattaagtatgtttcaggcggtcaagccatgcgcaatcaacaggttggcaattctgaa
attattacgtctgtccgctatggtaaaggtgctttgaaagcaacggatacaggggaccgc
accacacgaacttcaggagtggccgtgattgaaggcaataacccttctttacgtttgaag
gcttctgatcgcgtggttgtcaatatgggagcagcccataagaaccaagcttaccgacct
ttactcttgaccacagataacggtatcaaggcttatcattccgatcaagaagcggctggt
ttggtgcgctacaccaatgacagaggggaattgatcttcacagcggctgatattaaaggc
tatgccaaccctcaagtttctggctatttaggtgtttgggttccagtaggcgctgccgct
gatcaagatgttcgcgttgcggctagcacggccccatcaacagatggcaagtctgtgcat
caaaatgcggcccttgattcacgcgtcatgtttgaaggtttctctaatttccaagctttc
gccactaaaaaagaggaatataccaatgttgtgattgctaagaatgtggataagtttgcg
gaatggggtgtcacagattttgaaatggcaccgcagtatgtgtcttcaacagatggttct
ttcttggattctgtgatccaaaacggctatgcttttacggaccgttatgacttaggaatt
tccaaacctaataaatacgggacagccgatgatttggtgaaagccatcaaagcgttacac
agcaagggcattaaggtaatggctgactgggtgcctgatcaaatgtatgcttttcctgaa
aaagaagtggtaacagcaacccgtgttgataagtttggaaaaccggttgaaggctcacaa
attaagagtgttctttatgttgctgacagtaagagttctggtaaagatcaacaagccaag
tatgggggagctttcttagaggagctgcaagcgaagtatccggagctttttgcgagaaaa
caaatttccacaggggttccgatggatccttctgttaagattaagcaatggtctgccaag
tactttaatgggacaaatattttagggcgcggagcaggctatgtcttaaaagatcaggca
actaatacttactttaatatttcagataataaagaaataaacttccttcctaaaacattg
ttaaaccaagatagtcaagttggtttctcttatgacggtaaaggttatgtttattattca
acgagtggttaccaagccaaaaatactttcatcagcgaaggtgataaatggtattatttt
gataataacggttatatggtcactggtgctcaatcaattaacggtgttaattattatttc
ttatcaaatggtctacagctcagagatgctattcttaagaatgaagatggaacttacgct
tattatggaaatgacggtcgccgttatgaaaatggttattatcaattcatgagtggtgta
tggcgtcacttcaataatggtgaaatgagtgttggattaactgtaattgatggtcaggtt
caatactttgatgaaatgggctatcaagccaaaggaaaatttgtaacaactgccgatggt
aaaataagatattttgataagcaatctgggaacatgtatcgtaatcgttttattgaaaac
gaagaaggtaaatggctgtatctcggtgaagatggtgcagcagtgacaggatctcaaacc
attaacggtcaacacctgtactttagagcaaacggtgttcaggtcaagggtgaatttgtc
actgaccgctacggccgtatcagctattacgacagcaattcaggggatcaaatccgcaac
cgctttgtccgcaatgctcagggtcagtggttctactttgataacaatggctatgccgta
accggtgccagaaccattaacggtcaacacctatactttagagcaaacggtgttcaggtc
aagggtgaatttgtcactgaccgccacggtcgtatcagctattacgacggcaattcaggg
gatcaaatccgcaaccgctttgtccgcaatgctcagggtcaatggttctactttgataac
aatggctatgccgtaaccggtgccagaaccattaacggtcaacacctatactttagagca
aacggtgttcaggtcaagggtgaatttgtcactgaccgctacggccgtatcagctattac
gacagcaattcaggggatcaaatccgcaaccgctttgtccgcaatgctcagggtcagtgg
ttctactttgataacaatggctatgccgtaaccggtgccagaaccattaacggtcaacac
ctgtactttagagcaaacggtgttcaggtcaaaggtgaatttgtcactgaccgctacggc
cgtatcagttattacgatgctaactctggagaacgagttcggattaactaa

DBGET integrated database retrieval system