KEGG   Streptococcus mutans UA159: SMU_1005Help
Entry
SMU_1005          CDS       T00100                                 

Gene name
gtfC
Definition
glucosyltransferase-SI
Orthology
K00689  
dextransucrase [EC:2.4.1.5]
Organism
smu  Streptococcus mutans UA159
Pathway
Starch and sucrose metabolism
Two-component system
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:smu00500]
Environmental Information Processing; Signal transduction; Two-component system [PATH:smu02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
955738..960105
Genome map
AA seq 1455 aa AA seqDB search
MEKKVRFKLRKVKKRWVTVSVASAVVTLTSLSGSLVKADSTDDRQQAVTESQASLVTTSE
AAKETLTATDTSTATSATSQPTATVTDNVSTTNQSTNTTANTANFDVKPTTTSEQSKTDN
SDKIIATSKAVNRLTATGKFVPANNNTAHSRTVTDKIVPIKPKIGKLKQPSSLSQDDIAA
LGNVKNIRKVNGKYYYYKEDGTLQKNYALNINGKTFFFDETGALSNNTLPSKKGNITNND
NTNSFAQYNQVYSTDAANFEHVDHYLTAESWYRPKYILKDGKTWTQSTEKDFRPLLMTWW
PDQETQRQYVNYMNAQLGIHQTYNTATSPLQLNLAAQTIQTKIEEKITAEKNTNWLRQTI
SAFVKTQSAWNSDSEKPFDDHLQKGALLYSNNSKLTSQANSNYRILNRTPTNQTGKKDPR
YTADRTIGGYEFLLANDVDNSNPVVQAEQLNWLHFLMNFGNIYANDPDANFDSIRVDAVD
NVDADLLQIAGDYLKAAKGIHKNDKAANDHLSILEAWSYNDTPYLHDDGDNMINMDNRLR
LSLLYSLAKPLNQRSGMNPLITNSLVNRTDDNAETAAVPSYSFIRAHDSEVQDLIRNIIR
AEINPNVVGYSFTMEEIKKAFEIYNKDLLATEKKYTHYNTALSYALLLTNKSSVPRVYYG
DMFTDDGQYMAHKTINYEAIETLLKARIKYVSGGQAMRNQQVGNSEIITSVRYGKGALKA
TDTGDRTTRTSGVAVIEGNNPSLRLKASDRVVVNMGAAHKNQAYRPLLLTTDNGIKAYHS
DQEAAGLVRYTNDRGELIFTAADIKGYANPQVSGYLGVWVPVGAAADQDVRVAASTAPST
DGKSVHQNAALDSRVMFEGFSNFQAFATKKEEYTNVVIAKNVDKFAEWGVTDFEMAPQYV
SSTDGSFLDSVIQNGYAFTDRYDLGISKPNKYGTADDLVKAIKALHSKGIKVMADWVPDQ
MYALPEKEVVTATRVDKYGTPVAGSQIKNTLYVVDGKSSGKDQQAKYGGAFLEELQAKYP
ELFARKQISTGVPMDPSVKIKQWSAKYFNGTNILGRGAGYVLKDQATNTYFSLVSDNTFL
PKSLVNPNHGTSSSVTGLVFDGKGYVYYSTSGNQAKNAFISLGNNWYYFDNNGYMVTGAQ
SINGANYYFLSNGIQLRNAIYDNGNKVLSYYGNDGRRYENGYYLFGQQWRYFQNGIMAVG
LTRIHGAVQYFDASGFQAKGQFITTADGKLRYFDRDSGNQISNRFVRNSKGEWFLFDHNG
VAVTGTVTFNGQRLYFKPNGVQAKGEFIRDADGHLRYYDPNSGNEVRNRFVRNSKGEWFL
FDHNGIAVTGTRVVNGQRLYFKSNGVQAKGELITERKGRIKYYDPNSGNEVRNRYVRTSS
GNWYYFGNDGYALIGWHVVEGRRVYFDENGVYRYASHDQRNHWDYDYRRDFGRGSSSAVR
FRHSRNGFFDNFFRF
NT seq 4368 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaagtacgttttaaattacgtaaagtaaagaaaagatgggtgacagtatct
gttgcttcagctgtagtgactttgacctctctttcaggaagtctagtaaaagcagattca
actgacgaccgtcaacaggcggttacagaatctcaggctagtcttgtgacgacaagtgaa
gcagcaaaagaaactctgactgctactgatacaagtacagcaacttcagcaacatctcaa
ccaaccgccactgttactgataatgtttctacaacaaaccagtctacaaatactactgct
aatacagctaattttgacgttaaaccaacaacaacttcggaacagtctaaaactgataat
agtgacaaaataattgctacatcaaaagcggtaaaccgtttaactgcgactggtaaattt
gttcctgctaacaataatactgcacattcaagaactgtcactgataaaatagttccaata
aaaccaaagattggtaaattaaaacagccgtcatcacttagtcaagatgatattgcagcc
ttaggtaatgtcaaaaatatcagaaaagtgaacggtaaatattattattataaagaagat
ggaactcttcaaaagaattatgctttaaatattaatgggaaaactttcttctttgatgaa
acaggagcattatcaaataatactttacctagtaaaaagggtaatatcactaataatgat
aacactaacagctttgctcaatataatcaggtctatagtacagatgctgcaaacttcgaa
catgttgatcattatttgacagctgagagttggtatcgtcctaagtacatcttgaaggat
ggtaaaacatggacacagtcaacagaaaaagatttccgtcccttattgatgacatggtgg
cctgaccaagaaacgcagcgtcaatatgttaactacatgaatgcacagcttggtattcat
caaacatacaatacagcaaccagtccgcttcaattgaatttagctgctcagacaatacaa
actaagatcgaagaaaaaatcactgcagaaaagaataccaattggctgcgtcagactatt
tccgcatttgttaagacacagtcagcttggaacagtgacagcgaaaaaccatttgatgat
cacttacaaaaaggggcattgctttacagtaataatagcaaactaacttcacaggctaat
tccaactaccgtatcttaaatcgcaccccgaccaatcaaactgggaagaaggatccaagg
tatacagctgatcgcaccattggcggttacgaattccttttggccaacgatgtggataat
tccaatcctgtcgtgcaggccgaacaattgaactggctccactttctcatgaactttggc
aacatttatgccaatgatccggatgctaactttgattccattcgtgttgatgcggtggat
aatgtggatgctgacttgctccaaattgctggggattacctcaaagctgctaaggggatc
cataaaaatgataaggctgctaatgatcatttgtctattttagaggcatggagttataat
gatactccttaccttcatgatgatggcgacaatatgattaacatggataacaggttacgt
ctttccttgctttattcattagctaaacctttaaatcaacgttcaggcatgaatcctctg
atcactaacagtttggtgaatcgaactgatgataatgctgaaactgccgcagtcccttct
tattccttcatccgtgcccatgacagtgaagtgcaggacttgattcgcaatattattaga
gcagaaatcaatcctaatgttgtcgggtattctttcaccatggaggaaattaagaaggct
ttcgagatttacaacaaagacttattagctacagagaagaaatacacacactataatacg
gcactttcttatgccctgcttttaaccaacaaatccagtgtgccgcgtgtctattatggg
gatatgtttacagatgacgggcaatacatggctcataagacgatcaattacgaagccatc
gaaaccctgcttaaagctcgtattaagtatgtttcaggcggtcaagccatgcgcaatcaa
caggttggcaattctgaaattattacgtctgtccgctatggtaaaggtgctttgaaagca
acggatacaggggaccgcaccacacgaacttcaggagtggccgtgattgaaggcaataac
ccttctttacgtttgaaggcttctgatcgcgtggttgtcaatatgggagcagcccataag
aaccaagcttaccgacctttactcttgaccacagataacggtatcaaggcttatcattcc
gatcaagaagcggctggtttggtgcgctacaccaatgacagaggggaattgatcttcaca
gcggctgatattaaaggctatgccaaccctcaagtttctggctatttaggtgtttgggtt
ccagtaggcgctgccgctgatcaagatgttcgcgttgcggctagcacggccccatcaaca
gatggcaagtctgtgcatcaaaatgcggcccttgattcacgcgtcatgtttgaaggtttc
tctaatttccaagctttcgccactaaaaaagaggaatataccaatgttgtgattgctaag
aatgtggataagtttgcggaatggggtgtcacagattttgaaatggcaccgcagtatgtg
tcttcaacagatggttctttcttggattctgtgatccaaaacggctatgcttttacggac
cgttatgatttgggaatttccaaacctaataaatacgggacagccgatgatttggtgaaa
gccatcaaagcgttacacagcaagggcattaaggtaatggctgactgggtgcctgatcaa
atgtatgctctccctgaaaaagaagtggtaacagcaacccgtgttgataagtatgggact
cctgttgcaggaagtcagatcaaaaacaccctttatgtagttgatggtaagagttctggt
aaagatcaacaagccaagtatgggggagctttcttagaggagctgcaagctaaatatccg
gagctttttgcgagaaaacaaatttccacaggggttccgatggatccttctgttaagatt
aagcaatggtctgccaagtactttaatgggacaaatattttagggcgcggagcaggctat
gtcttaaaagatcaggcaaccaatacttacttcagtcttgtttcagacaacaccttcctt
cctaaatcgttagttaacccaaatcacggaacaagcagttctgtaactggattggtattt
gatggtaaaggttatgtttattattcaacgagtggtaaccaagctaaaaatgctttcatt
agcttaggaaataattggtattatttcgataataacggttatatggtcactggtgctcaa
tcaattaacggtgctaattattatttcttatcaaatggtattcaattaagaaatgctatt
tatgataatggtaataaagtattgtcttattatggaaatgatggccgtcgttatgaaaat
ggttactatctctttggtcaacaatggcgttatttccaaaatggtattatggctgtcggc
ttaacacgtattcatggtgctgttcaatactttgatgcttctgggttccaagctaaagga
cagtttattacaactgctgatggaaagctgcgttactttgatagagactcaggaaatcaa
atttcaaatcgttttgttagaaattccaagggagaatggttcttatttgatcacaatggt
gtcgctgtaaccggtactgtaacgttcaatggacaacgtctttactttaaacctaatggt
gttcaagccaaaggagaatttatcagagatgcagatggacatctaagatattatgatcct
aattccggaaatgaagttcgtaatcgctttgttagaaattccaagggagaatggttctta
tttgatcacaatggtatcgctgtaactggtaccagagttgttaatggacagcgcctctat
tttaagtctaatggtgttcaggctaagggagagctcattacagagcgtaaaggtcgtatc
aaatactatgatcctaattccggaaatgaagttcgtaatcgttatgtgagaacgtcatca
ggaaactggtactattttggcaatgatggctatgccttaattggttggcatgttgttgaa
ggaagacgtgtttactttgatgaaaatggtgtttatcgttatgccagtcatgatcaaaga
aaccactgggattatgattacagaagagactttggtcgtggcagcagcagtgctgttcgt
tttagacactctcgtaatggattctttgacaatttctttagattttaa

DBGET integrated database retrieval system