KEGG   Streptococcus mutans UA159: SMU_1191Help
Entry
SMU_1191          CDS       T00100                                 

Gene name
pfk
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
smu  Streptococcus mutans UA159
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMU_1191 (pfk)
   01230 Biosynthesis of amino acids
    SMU_1191 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMU_1191 (pfk)
   00030 Pentose phosphate pathway
    SMU_1191 (pfk)
   00051 Fructose and mannose metabolism
    SMU_1191 (pfk)
   00052 Galactose metabolism
    SMU_1191 (pfk)
  Energy metabolism
   00680 Methane metabolism
    SMU_1191 (pfk)
Enzymes [BR:smu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SMU_1191 (pfk)
Protein phosphatases and associated proteins [BR:smu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SMU_1191 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1132337..1133350)
Genome map
AA seq 337 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAVRAVVRKAISEGMEVCGINRGYAGMVEGDIFPLDAKGVSNI
LSRGGTFLQSARYPEFAKLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDYTIGFDTAVNTATDALDKIRDTSFSHGRTFVVEVMGRNAGDIALWS
GIAAGADQIIIPEEPYDIKEVVANVKNGYLSKSKNHHLIVLAEGVMHGEEFAAQMKEAGD
NSDLRVTNLGHILRGGAPTPRDRVIASWMGAHAVELLREGKGGLAIGIQNEELVEHPILG
SAEDGALFSLTEQGEIVVNNPHKARLDFAALNRDLSN
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgaccagtggcggagacgctcctggtatgaatgctgccgtt
cgtgcagtcgttcgtaaagcaatttctgaaggaatggaagtttgcggaatcaatcgtggt
tatgctggtatggttgaaggagatatcttcccgcttgacgctaaaggtgtatcaaacatc
ctttctcgtggagggacatttctccagtccgcacgttaccctgaatttgcaaagcttgag
gggcaattaaagggtatcgagcaactcaaaaagcatggcattgaaggagtcgttgttata
ggtggcgatggttcttatcatggtgcgatgcgcttgactgagcatggttttcctgctgtc
ggtcttccgggtacaattgataacgatatcgtaggaactgattatacaattggttttgat
actgcagtaaacactgctacggatgcacttgataaaattcgtgatacctcatttagtcac
ggcagaacttttgttgttgaggttatgggacgtaatgcaggagatattgctctttggtct
ggtattgctgccggtgctgaccaaattattattcctgaagagccctatgatattaaagag
gttgtcgccaatgtgaaaaatggctatcttagtaagtctaaaaaccaccatctcattgtt
cttgccgaaggcgttatgcatggtgaagagtttgctgctcagatgaaggaagcaggagat
aatagtgatcttcgtgttaccaaccttgggcatatcctgcgcggtggtgcaccaactcct
cgtgatcgtgtgattgcttcatggatgggagcccatgccgttgaattgctcagggaagga
aaaggcggtcttgccattggtattcaaaatgaggagttggttgagcatccaattcttgga
tctgcggaagacggtgcactctttagtttaacagaacaaggcgagatcgttgtaaataat
ccgcataaagcacgtcttgattttgctgctttgaatcgtgatttgtccaactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system