KEGG   Streptococcus mutans UA159: SMU_1270Help
Entry
SMU_1270          CDS       T00100                                 

Gene name
hisD
Definition
bifunctional histidinal dehydrogenase/histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
smu  Streptococcus mutans UA159
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SMU_1270 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    SMU_1270 (hisD)
Enzymes [BR:smu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SMU_1270 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1198698..1199981)
Genome map
AA seq 427 aa AA seqDB search
MKRLTGTNEKISNILYQEQLELSKENLDVEATVREIIEKVKEEGDEALRAYSEKFDHVVL
SELHVSDQVVNEAFDKIDKDVLTALENAKANIESYHKQQLKGGFEDQPSQGVLRGQLIRP
IERVGVYVPGGTAAYPSSVLMNVIPAKIAGVKEIIMITPPQEHFVPAILVAAKLAGVDKI
YQVGGAQGIAALAYGTQTLPKVDKITGPGNIFVATAKKLVYGVVGIDMIAGPSEIGVIAD
STANPVYVAADLLSQAEHDVHARAILVTNSAELADAVELEIEKQLQTLPRQAIARPSIEN
NGRIIIAQDVESMFELMNLVAPEHLEIAIDKAYDYLERVQNAGSIFLGHYTSEPIGDYYA
GANHVLPTTATSRFSSALGVHDFVKRIQYTQYSKAAVNAAEKDITTLAYAEGLQAHARAI
EVRNDKN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtttaacaggaacaaatgaaaagatttctaacattttatatcaagagcagctg
gaactcagcaaggaaaatttagatgttgaagcgactgttcgtgagattatcgaaaaagtt
aaagaagaaggtgatgaggctttacgagcttattctgaaaaatttgatcatgttgtatta
tccgaattgcacgtttcggatcaagttgtcaatgaagcttttgacaagattgataaagat
gttctcacagcacttgaaaatgcaaaagctaatattgaatcctaccataagcaacaatta
aaaggaggttttgaagatcagccctctcaaggggtgcttcgcggacagctgattcgtccc
attgagcgcgttggtgtctatgttcccggtggaacagcagcttatccatcatctgtactc
atgaatgttattccagctaaaattgctggtgtgaaagaaatcattatgattacaccgccg
caggaacattttgtcccagctattttggttgctgccaaactggccggtgttgataaaatt
tatcaggttggcggtgcccaaggaattgcagctttggcttatggcacacaaacactgcct
aaagtggataagattacaggcccgggcaatatctttgtagcaactgctaaaaagttggtt
tatggtgtggtaggcattgatatgattgctggaccatcggaaattggtgtcatcgcagat
agtacagccaatcctgtttatgtggctgctgatttgctgtctcaagcagaacatgatgtc
catgcccgtgctattctcgtgactaactcagctgaattggctgatgcggttgaattagaa
attgaaaagcagttgcaaaccttgccacgtcaggctatcgctcgtccttcaattgaaaat
aatggtcgaattattattgcccaagatgtggagagcatgtttgaactcatgaatttagtg
gcgccagagcacttagaaattgctatagataaagcttatgattatttggaacgagtgcaa
aatgctggttcgattttccttggacattacaccagtgaaccaattggtgattattatgct
ggtgccaaccatgtgctgccgacaacagctaccagtcgtttttcatcagcacttggtgtg
catgactttgtcaaacgcatccaatacacgcaatacagtaaggctgccgttaatgcagct
gaaaaagacattacaacccttgcctatgccgaaggtttgcaggcacatgccagagcaatt
gaggtgagaaatgacaaaaactaa

DBGET integrated database retrieval system