KEGG   Streptococcus mutans UA159: SMU_1421Help
Entry
SMU_1421          CDS       T00100                                 

Gene name
pdhC
Definition
(RefSeq) branched-chain alpha-keto acid dehydrogenase E2 subunit
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smu  Streptococcus mutans UA159
Pathway
smu00010  Glycolysis / Gluconeogenesis
smu00020  Citrate cycle (TCA cycle)
smu00620  Pyruvate metabolism
smu01100  Metabolic pathways
smu01110  Biosynthesis of secondary metabolites
smu01120  Microbial metabolism in diverse environments
smu01130  Biosynthesis of antibiotics
smu01200  Carbon metabolism
Module
smu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMU_1421 (pdhC)
   00020 Citrate cycle (TCA cycle)
    SMU_1421 (pdhC)
   00620 Pyruvate metabolism
    SMU_1421 (pdhC)
Enzymes [BR:smu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SMU_1421 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N NQRA HlyD_D23 PTS_EIIA_1
Motif
Other DBs
NCBI-GeneID: 1028680
NCBI-ProteinID: NP_721779
UniProt: Q8DTD0
Position
complement(1349952..1351205)
Genome map
AA seq 417 aa AA seqDB search
MATEIVMPKLGLTMTEGLINQWLVKEGDTVAAGDPVLEISSEKLTSEVEAPEAGVILKIV
KGEGETVPCKQIIAWIGQEGEAVPDAAGDAPEVDTEAESEVASAGQTVVPEESRTVSAAP
VAEKHEDGRIFITPLARKIAKEKGLDITYIKGTGGNGRITRRDVEAFNPASIPTAEPVTA
LSAPTNVNYGVGLTGIRKVIAERMMSSIHSSAQLTLHRKADVTPLMAFRQDIKTKVNAPL
ENGEIGITTLLTKAVTKALKDYPEANAWYAGGQYEEKEDIHIGMATALSDGLVVPVIRHA
DKLTLSDLGRTIKEEAEQVRKGTLDPSLYSGSTFSITNLGAQGIEYFTPILNAPEVAILG
VGAIQKALTLDENGQVAEKQFLPLSLTFDHQVLDGAPAAEFLGAVISYLEDAYSLVF
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggctacagaaatcgtgatgcctaaattaggtttaaccatgacagaagggctaattaac
caatggctcgttaaagaaggcgacacagttgcagctggcgatcccgtgttggaaattagt
tctgaaaagttaacaagtgaagttgaagctccagaagctggtgttattttaaaaatagtt
aagggagaaggtgagactgttccttgtaaacaaatcattgcttggattggtcaagaaggt
gaggctgttcctgacgctgcaggtgacgctccagaagtagatacagaagctgaaagtgaa
gttgcttcagcagggcaaacagtagttccagaagaaagcaggactgtttcagcagcgccc
gttgctgaaaagcatgaagacggacggatttttatcacaccgctggctcgaaagattgcc
aaggaaaaagggctagacattacttatatcaaaggaacaggcggtaacggacgtatcaca
cgccgtgacgttgaagcctttaatcctgctagcattcctacagctgaacctgtaacagct
ttaagtgctccaacaaatgtaaactatggtgttggtttaacaggtatacgcaaagtcatt
gctgagcgcatgatgagtagtatccattctagtgctcaattaacgcttcatcgaaaggca
gatgttacgcctttaatggctttcaggcaagatataaaaactaaggttaatgcaccgctt
gaaaacggggaaattggcattacaaccttattgaccaaagcggtaacgaaggctttgaaa
gattatcctgaagcgaatgcttggtatgcaggcggtcaatatgaagaaaaagaagatatt
catattggtatggcaactgctttgagtgatggtttggtcgttcctgttattcgtcatgct
gataaattaacgctgtcagatttgggacgaactattaaagaagaagcagaacaagtacgt
aaaggaactctggatccatccttgtattcaggttccacattctctattaccaatctaggt
gctcaaggcattgaatactttacaccgattttgaatgcacctgaagttgctatcttaggt
gttggggctatccagaaagctttgactcttgatgagaatggtcaagtagctgaaaaacaa
tttttaccacttagtttgacctttgaccatcaagtcttagatggtgcaccagcagctgaa
tttttaggagctgttatctcctacttggaagatgcttatagtctggtattctaa

DBGET integrated database retrieval system