KEGG   Streptococcus mutans UA159: SMU_1429Help
Entry
SMU_1429          CDS       T00100                                 

Gene name
murC2
Definition
UDP-N-acetylmuramyl tripeptide synthetase MurC
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
smu  Streptococcus mutans UA159
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:smu00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:smu00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1361015..1362358
Genome map
AA seq 447 aa AA seqDB search
MTLKSRIGILAGKTAHFFLSKIGRGSTLPGKIALKCDKDILDTLAKDYDIVVVTGTNGKT
LTTALTVGILKEAYGQVLTNPSGANMITGITSTFLTAKKSRNGKKIAVLEIDEASLPKIT
DYLKPSLFVFTNIFRDQMDRYGEIYTTYQMILDGAAKAPKATILANGDSPLFNAKTVVNP
VRYYGFDTKKEAAHLAHYNTEGIVCPKCEYILQYKLNTYANLGDYICPNCGFHRPHLDYS
LTQLTKISNTQAEFIIDGQDYKINVGGLYNIYNALAAVAVAEFLGVTPEQIKAGFDKSRA
VFGRQETFKIGDKSCTLVLIKNPVGASQALEMIKLAPYPFTLSVLLNANYADGIDTSWIW
DANFESILDMNIPQIFTGGVRHSEIARRLRVTGYNETKIEQAEKLEDILSMIEKQEADHA
YILATYTAMLEFRELLASRHAVRKEMH
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgactttaaaatcaagaataggaattttagctggtaagacagcacacttttttctcagt
aaaatagggcgcggctctaccttacctggaaaaattgctcttaagtgcgataaagatatt
ttagatacacttgctaaagattatgacattgttgttgtcacaggcactaatggaaaaacc
ttaacaacagctttaacagtaggaattttaaaagaggcttacggtcaggtgctaaccaat
cctagtggtgccaatatgattacaggaattacctcaacttttttaactgctaaaaaatct
agaaatggtaaaaagattgcggtgctggagattgatgaagccagccttcctaaaattaca
gattatctaaagcccagcctttttgttttcaccaatatttttcgtgatcaaatggatcgt
tacggtgaaatttatactacctatcaaatgattttggacggtgctgccaaagcgccaaaa
gcaactattttagctaatggcgatagcccactctttaacgccaaaacagttgttaatcct
gtgcgttactatggttttgatacaaaaaaagaagctgctcacttggcacattacaatact
gaaggcatcgtctgtcctaagtgcgaatatatcctacaatacaagcttaatacttatgcc
aacttgggcgactacatctgccccaactgtggttttcaccgtcctcatctggattacagc
ttgactcagctaaccaagattagcaacactcaagctgagttcatcattgacggacaggat
tataagatcaatgtcggcggcctttataatatctataatgccttggctgcagtcgctgtt
gcagaatttctcggtgtaactcctgaacaaatcaaggctggctttgacaagagccgtgct
gtttttggacgccaagaaacctttaaaatcggcgataagtcatgtactcttgttttaata
aaaaatcctgttggtgccagtcaagcactagaaatgattaaactagcaccttatcctttc
accttatctgtccttctcaatgccaattatgctgatggcattgataccagctggatttgg
gatgcgaattttgagagcattttagatatgaatattccacaaatctttacaggtggtgtc
cgccattcagaaatagccagacgtctgcgtgttactggttacaatgaaacaaagattgag
caggctgaaaaacttgaagacattctaagtatgattgaaaaacaagaggctgatcatgcc
tacattctagctacttacacagccatgttggaattccgcgaattactagccagccgtcac
gcagtaagaaaggagatgcattaa

DBGET integrated database retrieval system