KEGG   Streptococcus mutans UA159: SMU_1460Help
Entry
SMU_1460          CDS       T00100                                 

Gene name
rmlC
Definition
dTDP-4-keto-L-rhamnose reductase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
smu  Streptococcus mutans UA159
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SMU_1460 (rmlC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SMU_1460 (rmlC)
Enzymes [BR:smu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SMU_1460 (rmlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1389227..1389688)
Genome map
AA seq 153 aa AA seqDB search
MVPLGFPESFFAEGKLQNNVSFSRKNVLRGLHAEPWDKYISIADEGKVLGSWIDLREGDS
FGHVYQAVIDASKGIFVPRGVANGFQVLSDKVSYSYLVNDYWALELKPKYAFVNYADPTL
GIEWENLEEAQVSEADKNHPLLKDVKPLKAEDL
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggtgccgctaggttttccagaaagcttctttgcagaaggcaaattgcaaaataatgtt
agcttttcccgtaaaaatgttttacgcggtctgcacgcagaaccatgggataaatacatt
tcaatagcggacgagggaaaggttctcggttcttggattgatctgcgtgaaggcgatagt
tttggtcatgtttaccaagcagttattgatgcttccaaaggtatctttgttccccgcggt
gtggctaatggtttccaagtcttatctgacaaggtttcttacagttatctcgttaatgac
tactgggcgcttgaactcaaaccaaaatacgctttcgtcaactatgctgatccaacatta
ggaattgaatgggaaaatttggaagaagcgcaagtctcagaagcggataaaaaccaccca
ttgctcaaagatgttaaaccattaaaagcagaagatttgtga

DBGET integrated database retrieval system