KEGG   Streptococcus mutans UA159: SMU_148Help
Entry
SMU_148           CDS       T00100                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
smu  Streptococcus mutans UA159
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SMU_148 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMU_148 (adhE)
   00620 Pyruvate metabolism
    SMU_148 (adhE)
   00650 Butanoate metabolism
    SMU_148 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    SMU_148 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SMU_148 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SMU_148 (adhE)
   00626 Naphthalene degradation
    SMU_148 (adhE)
Enzymes [BR:smu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SMU_148 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SMU_148 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
150120..152789
Genome map
AA seq 889 aa AA seqDB search
MAKETKTEALTAEEAAKQYTNSLVEKALKAEKVYATYTQEQVDKIVAAMALAGSEASLQL
AKEAHDETGRGVVEDKDTKNHFATEYVYERIKNEKTVGIIGEDKVAGSIEIAAPLGVLAG
IVPTTNPTSTTMFKILVALKTRNAIVFAFHPAAQKCSAHAAQILYDAAVKAGAPENIVQW
IETPSIANTGALISNKGIASILATGGPGMVNAALKSGNPSMGVGAGNGAVYVDATANLER
AVEDLLLSKRFDNGMICATENSAVVEAPIYKEWLAKMQEKGAYLVPKKDYKKFEDFVFND
NHGVNGPVAGMSAKWICEQAGVTLPEGKDVLLFELDKKKIGEKLSSEKLSPLLSVYKAKD
RKDGIDIVAALLDYQGAGHNCAIQIGSQADPFVAEYGDALNSSRVLVNQPDSVGGIGDVY
TDALQASLTLGTGSWGKNSLSHNLSTGDLLNVKTVAKRRNRPQWVRLPEKTYYEKNAISY
LQDETETMTRAIIVADPGMLQFGFVDTVLAQLSLRDEKVATSIYGTIKPDPTLGQTIEIA
RQMRDFKPDTVIAVGGGSALDAAKIARYIYEYSLDQEADFLDSYEKVSELFLELQQKFID
IRKRIVRFKHQTVTRLFCIPTTSGTGSEVTPYAVITDDFTHVKYPLTDYELTPQVAIVDP
EFVMTVPKRTVALSGLDTLSHALESYVSVMASDFTRPWSMEAIRLVIENLEDSYNFDPKN
PTLRGEQARENMHYAATLAGMAFSNAFLGINHSLAHKAGGEFGLPHGLAISIAMQHVIRY
NGVAGNVKRSVYPRYEEYRAQRDYADIARALGLKGKDDAELVEALCARIDQLMHAVDVEP
KLSANGVTKKAFDAAVDRLASLAYDDQCTPANPRQPYIEEMKQLLIDQF
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaacaaaaacagaagcactcactgctgaagaagcagctaagcagtatacg
aatagcttagttgaaaaagcgttaaaggctgaaaaagtttatgcaacttatacacaagaa
caggtagataaaattgttgcagctatggcgcttgctggttctgaggcgtccctgcagtta
gctaaagaagctcacgatgaaacaggccgtggggttgtcgaagataaagatactaaaaac
cactttgcgacagaatatgtatatgaacgcataaaaaatgaaaaaacggttggcatcatt
ggtgaagataaagttgctggcagtatcgaaattgcagcaccacttggtgtcttggcaggt
atcgtaccaacaactaacccaacatcaacgactatgtttaaaatcttagtcgcattgaaa
acacgcaatgcaatcgtctttgctttccacccagcagctcaaaaatgttctgctcatgcc
gcccaaatcttgtatgacgcggcggttaaagccggcgctcctgaaaatattgttcaatgg
attgaaacaccatccatcgcaaacacgggagctttgatttccaacaaaggcattgcttca
atccttgcaactggcggacctggcatggttaatgcagcccttaaatctggtaatccatcg
atgggtgttggtgcaggtaatggtgctgtttatgtggatgcaactgctaatcttgaacgt
gcggttgaagaccttcttctttctaagcgttttgacaatggtatgatttgtgcgactgaa
aattcggcagttgtggaagcaccaatttataaagaatggcttgctaaaatgcaggaaaaa
ggcgcttaccttgttcctaaaaaagattacaaaaaatttgaagattttgtttttaatgac
aaccatggtgttaacggaccggttgctggtatgtcggcgaaatggatctgtgaacaagcc
ggtgtgacattgccagaaggcaaagatgttctcttatttgaacttgataagaaaaaaatt
ggtgagaaattatcatcagaaaaactctctccgcttctttctgtttataaagccaaagat
cgcaaagatggtattgatattgtagcagcccttcttgattaccaaggtgctggtcataac
tgtgctatccaaatcggttcacaagctgacccatttgtcgctgaatatggagatgccctc
aattcatctcgtgttttggttaaccaaccagactcagtcggtggtatcggtgacgtttat
acagacgcattgcaagccagcttaactcttggaacaggatcatgggggaaaaattcattg
tcacacaacttatctactggcgacctcttgaatgtgaaaactgttgcgaaacgccgcaac
cgtcctcaatgggttcgtttaccagaaaaaacttactacgaaaaaaatgctatttcatac
ttgcaggatgaaactgaaacaatgacgcgtgctatcatcgttgccgacccaggtatgctt
caatttggttttgttgacactgtccttgctcagctgtcccttcgggatgaaaaagtggca
acttcaatttatggtactattaaaccagatccaacactcggtcagactattgaaattgct
agacaaatgcgtgacttcaaaccagatactgttattgcagttggtggcggttctgccctt
gatgcagccaaaattgcgcgttatatctatgaatattcgttggatcaagaagcagatttc
cttgatagttatgaaaaagtcagtgagctcttccttgaattgcagcaaaaattcattgat
attcgtaagcggattgttcgcttcaagcatcagacagtgactcgtctcttctgtatccca
acaacatctggtacgggttcagaagtgacaccttatgccgttattactgatgatttcaca
cacgtgaaatacccattgactgattatgaattgacaccgcaagttgctattgttgatcca
gaatttgtcatgacagtgcctaaacgtacagtagctctttcaggacttgatactttgtca
catgctcttgaatcttacgtatctgttatggcatctgatttcacacgtccatggtctatg
gaagctatcagattggttatcgaaaacttggaagattcttataactttgatcctaagaat
ccaacacttcgtggagaacaagcacgtgaaaacatgcattatgcagcaactttagcaggt
atggccttctcaaatgccttccttggaattaaccactcactcgcccacaaggctggcggt
gaatttggacttcctcatggtcttgctatctcaattgctatgcagcatgttattcgctac
aatggcgttgcaggaaatgtgaaacgttctgtttacccgcgttatgaagaataccgtgcc
caacgtgattatgcggatattgctcgcgctcttggacttaaagggaaagatgatgcagaa
ttggttgaagcactctgtgcacgtattgatcaattaatgcatgctgtagatgttgagcct
aagttatctgctaatggggttactaagaaggcttttgatgcagctgttgatagattggca
agcttggcttatgatgatcaatgtacaccagctaatccacgtcagccttacattgaagag
atgaagcagctcttgattgatcagttctaa

DBGET integrated database retrieval system