KEGG   Streptococcus mutans UA159: SMU_1565Help
Entry
SMU_1565          CDS       T00100                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
smu  Streptococcus mutans UA159
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:smu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1490333..1491862)
Genome map
AA seq 509 aa AA seqDB search
MEKRASGILMHISSLPGKFGIGTFGQEAYDFVDFLKKTGQTYWQLLPLTTTSYGDSPYQS
FSAVAGNVNFIDFKKLQEAGLLDEDDYNSVSFGEDEEIVDYALLFKVRRPILEKAVINFL
ADKTNLKKLALFEEKNETWLDDYAEFMAIKEHFGNKSLQEWGDKKAIRRDEERLVRYRHL
LADEISYHKVTQYFFFEQWLALKAYANKNKIKIIGDMPIYVAKDSVEVWTMPELFKMDDD
LQPLSVAGCPPDEFSDEGQLWGNPIYDWKKHRETGFAWWIYRIQESFKIYDILRIDHFKG
FSDYWEIKGNSKTAKNGSWHPGPGIALFRAVQNVLGDMPIIAEDLGYVDDRARQLLKETG
FPGMKILEFGFYDLSGRSVDIPHHYVQNSVAYIGTHDNDVVNGWYDRLTVEQEEFVDAYT
NRKPIEPVNQAMLRLLFSTVSNTAILTMQDLLNKPASSRMNTPSTIGGNWQWRMRAKDLT
QDKINFLSKLTKLYQRGNEENDTKNKTIQ
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaacgcgcaagtggtatcctgatgcatatcagttctctaccgggaaaatttgga
attggtacttttgggcaggaagcttatgattttgttgatttcctaaaaaaaacaggtcaa
acatattggcagctcttacccttaacgacaacgagttatggtgattctccttaccaatct
ttttctgccgttgctggtaatgtgaattttattgattttaagaaattacaagaagctggc
ttattggacgaggatgactataattctgtttcttttggagaagacgaagaaattgttgat
tatgctctattatttaaagtacgtcggccaattttggaaaaggctgttatcaattttctg
gcagacaagactaatctgaaaaaattagctttgtttgaagaaaaaaatgaaacttggctt
gatgactatgctgaatttatggccatcaaggagcattttggcaataagtctttgcaagag
tggggcgataaaaaggctattcgccgtgatgaggagcgtttggtacgttatcgtcatttg
ttggccgatgaaattagctaccataaggttacacagtacttcttcttcgaacaatggctg
gcgctgaaagcttatgctaataaaaataagatcaaaattattggcgatatgcctatctat
gtagctaaagacagtgttgaagtctggactatgcctgaactctttaagatggatgatgac
ttgcagcctttgtcggttgctggctgtccgcccgatgaatttagtgatgagggtcagttg
tggggaaatcctatttatgattggaaaaagcatcgagaaacaggctttgcttggtggatt
tatcgtattcaagaaagttttaagatctatgatatcttacggatagatcactttaaaggt
ttctcagattattgggaaattaaaggtaattccaaaactgcaaaaaatggcagctggcat
ccaggacctggtattgctctctttagggctgttcaaaatgttttgggcgatatgccaatt
attgcagaggatttgggttacgtagatgatagagccagacagcttctaaaagaaacaggc
tttccaggcatgaaaattttagaatttggtttctatgatttaagcggccgcagtgttgat
attccccaccattatgttcaaaatagtgttgcttatattgggacgcatgataatgatgtt
gtcaatggttggtatgatcgtcttactgttgagcaagaagaatttgtggatgcttatact
aatcgtaagccaattgagccggttaatcaggctatgcttagactgctcttttcaactgtc
agcaatacagctattttaaccatgcaggatttgctcaataagccagccagctctagaatg
aataccccatcaacaatcggcggtaactggcaatggcggatgagagcaaaagatttaaca
caagataaaataaactttttaagtaaattaacgaaactttatcaaagaggaaatgaagaa
aatgacacaaaaaacaaaacaattcagtaa

DBGET integrated database retrieval system