KEGG   Streptococcus mutans UA159: SMU_1565Help
Entry
SMU_1565          CDS       T00100                                 

Gene name
malQ
Definition
(RefSeq) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
smu  Streptococcus mutans UA159
Pathway
smu00500  Starch and sucrose metabolism
smu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SMU_1565 (malQ)
Enzymes [BR:smu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SMU_1565 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77 PSD4
Motif
Other DBs
NCBI-GeneID: 1028801
NCBI-ProteinID: NP_721905
UniProt: Q8DT30
Position
complement(1490333..1491862)
Genome map
AA seq 509 aa AA seqDB search
MEKRASGILMHISSLPGKFGIGTFGQEAYDFVDFLKKTGQTYWQLLPLTTTSYGDSPYQS
FSAVAGNVNFIDFKKLQEAGLLDEDDYNSVSFGEDEEIVDYALLFKVRRPILEKAVINFL
ADKTNLKKLALFEEKNETWLDDYAEFMAIKEHFGNKSLQEWGDKKAIRRDEERLVRYRHL
LADEISYHKVTQYFFFEQWLALKAYANKNKIKIIGDMPIYVAKDSVEVWTMPELFKMDDD
LQPLSVAGCPPDEFSDEGQLWGNPIYDWKKHRETGFAWWIYRIQESFKIYDILRIDHFKG
FSDYWEIKGNSKTAKNGSWHPGPGIALFRAVQNVLGDMPIIAEDLGYVDDRARQLLKETG
FPGMKILEFGFYDLSGRSVDIPHHYVQNSVAYIGTHDNDVVNGWYDRLTVEQEEFVDAYT
NRKPIEPVNQAMLRLLFSTVSNTAILTMQDLLNKPASSRMNTPSTIGGNWQWRMRAKDLT
QDKINFLSKLTKLYQRGNEENDTKNKTIQ
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaacgcgcaagtggtatcctgatgcatatcagttctctaccgggaaaatttgga
attggtacttttgggcaggaagcttatgattttgttgatttcctaaaaaaaacaggtcaa
acatattggcagctcttacccttaacgacaacgagttatggtgattctccttaccaatct
ttttctgccgttgctggtaatgtgaattttattgattttaagaaattacaagaagctggc
ttattggacgaggatgactataattctgtttcttttggagaagacgaagaaattgttgat
tatgctctattatttaaagtacgtcggccaattttggaaaaggctgttatcaattttctg
gcagacaagactaatctgaaaaaattagctttgtttgaagaaaaaaatgaaacttggctt
gatgactatgctgaatttatggccatcaaggagcattttggcaataagtctttgcaagag
tggggcgataaaaaggctattcgccgtgatgaggagcgtttggtacgttatcgtcatttg
ttggccgatgaaattagctaccataaggttacacagtacttcttcttcgaacaatggctg
gcgctgaaagcttatgctaataaaaataagatcaaaattattggcgatatgcctatctat
gtagctaaagacagtgttgaagtctggactatgcctgaactctttaagatggatgatgac
ttgcagcctttgtcggttgctggctgtccgcccgatgaatttagtgatgagggtcagttg
tggggaaatcctatttatgattggaaaaagcatcgagaaacaggctttgcttggtggatt
tatcgtattcaagaaagttttaagatctatgatatcttacggatagatcactttaaaggt
ttctcagattattgggaaattaaaggtaattccaaaactgcaaaaaatggcagctggcat
ccaggacctggtattgctctctttagggctgttcaaaatgttttgggcgatatgccaatt
attgcagaggatttgggttacgtagatgatagagccagacagcttctaaaagaaacaggc
tttccaggcatgaaaattttagaatttggtttctatgatttaagcggccgcagtgttgat
attccccaccattatgttcaaaatagtgttgcttatattgggacgcatgataatgatgtt
gtcaatggttggtatgatcgtcttactgttgagcaagaagaatttgtggatgcttatact
aatcgtaagccaattgagccggttaatcaggctatgcttagactgctcttttcaactgtc
agcaatacagctattttaaccatgcaggatttgctcaataagccagccagctctagaatg
aataccccatcaacaatcggcggtaactggcaatggcggatgagagcaaaagatttaaca
caagataaaataaactttttaagtaaattaacgaaactttatcaaagaggaaatgaagaa
aatgacacaaaaaacaaaacaattcagtaa

DBGET integrated database retrieval system