KEGG   Streptococcus mutans UA159: SMU_1867cHelp
Entry
SMU_1867c         CDS       T00100                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
smu  Streptococcus mutans UA159
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SMU_1867c
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMU_1867c
  Lipid metabolism
   00071 Fatty acid degradation
    SMU_1867c
  Amino acid metabolism
   00350 Tyrosine metabolism
    SMU_1867c
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SMU_1867c
   00626 Naphthalene degradation
    SMU_1867c
Enzymes [BR:smu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SMU_1867c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1759940..1760989)
Genome map
AA seq 349 aa AA seqDB search
MKTAVFVKAGQMAIETIEKPSVIEVDDAIIRVVRACVCGSDLWSYRGDDDKATHSANSGH
EIIGIVDEVGSAINTVKKGDFVIAPFTHGCGHCAACRAGFEGGCQGHDRSTNFSSGYQAE
YVRYAHADWSLVKIPGQPSDYSEGMIASLLALADVMPTGYHAARVANVQKGDTVAVVGDG
AVGLCAVIAAKMRGAKRIIIMSRHKDRQELALEFGATDIVEERGEEGVAKVLELTNGDGV
DAALECVGTQLSTETALAIARPGASIGRVGVPHTKDINLSDYFFQNAIIAGGPASVTTYD
KSVLLKAVLDGEINPGKVFTQSYSLDDIDQAYKDMQERKTIKSMVVVSK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagcagtgtttgtaaaagctggtcaaatggccattgaaactattgagaagcca
agtgttattgaagttgatgatgcgatcatccgtgtcgtccgtgcttgtgtctgtggttct
gatctgtggtcttatcgtggagatgatgacaaagctacgcattcagccaactcaggtcac
gaaattatcggaatcgttgatgaagttggctctgctattaatacagtgaaaaaaggagac
tttgttattgcaccattcacgcatggttgcggtcattgtgcagcttgtcgtgctggtttt
gaaggaggttgtcaaggacacgatcggtcaacaaacttttcaagtggttatcaagccgaa
tatgttcgttatgctcatgctgattggtctttagtaaaaattccgggtcaacctagcgat
tattcagaaggtatgattgcttcgcttttagctttggcggatgttatgccaacaggctat
catgcagcgcgcgtggccaatgttcaaaagggggatacggttgcagttgttggcgatgga
gcggttggactctgtgctgttatcgcagctaaaatgcgtggagctaaacgtatcattatc
atgagtcgccacaaggatcgtcaggaattggcgttggaatttggcgctactgatattgta
gaagagcgcggcgaagaaggtgtagctaaagttcttgaactgacaaatggcgatggtgtt
gatgccgctcttgaatgtgtcggaactcagctgtctactgaaacagcgttagctattgcc
cgtccaggtgcatctatcggtcgcgtgggtgttccacataccaaagatattaatctttcc
gattacttcttccaaaacgctattattgcaggtggaccagcatcagtaacgacttatgac
aaatcggttcttctcaaggctgttcttgatggtgagattaatccaggaaaggtcttcact
caatcttacagcttagatgatattgatcaagcctataaggatatgcaggagcgcaagacc
attaagtctatggttgtcgttagcaaatga

DBGET integrated database retrieval system