KEGG   Streptococcus mutans UA159: SMU_1875Help
Entry
SMU_1875          CDS       T00100                                 

Definition
exodeoxyribonuclease V
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
smu  Streptococcus mutans UA159
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:smu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SMU_1875
Enzymes [BR:smu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SMU_1875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1766522..1768885
Genome map
AA seq 787 aa AA seqDB search
MTYYFSGTIDRVIFENTSNFFKIILLEIDDTDSDFDDFEIIVTGTIADVIEGENYTFWGE
LTQHPKYGQQLKVERYQRAKPSSAGLIKYFSSQHFKGIGKKTAEKIIHLYGDDPIDNILE
DPDKLESISGLSKANRENLVSKLRLNYGAEQILAKLAEYGLNNKTAVQIFERYKEESLTV
ITENPYQLVEDIQGIGFKMADKLAEQVGINSDAPQRFRAALVHTLLETSIDKGDTYIEAK
ELLEKSLFILEEVRQVELDPSQIAQELTQLISEDKVQNIGTKIFDNTLFYAESGIHKHLT
RILDRPLEKEISSQDIQTEIKHIQAEFNINYDKAQKNAIQKAIQSKVFLLTGGPGTGKTT
VINGIIKAYANLHQIDLQKSDRPIILAAPTGRAARRMNELTGLPSATIHRHLGLNGDSEY
QALDDFLDCDLIIIDEFSMVDTWLANQLFSAIASNTQVIIVGDSDQLPSVGPGQILADLL
KINRLPQVSLTKIFRQSEDSTIVTLANQIRQGRLPTDFTAKKADRSYFEAQSTHIPQMIQ
KIVSSALKSGIDAQEIQILAPMYRGQAGITHLNKLMQDLLNPLNNQLEFQFNDLHFRKGD
KVLHLINDAQINVFNGDIGYITDLIPAKYTESKQDEMILDFDGTEINYPRNEWLKITLAY
AMSIHKSQGSEFKVVILPVTRQSGRLLQRNLIYTAITRSKSKLVMLGEIAAFDNAIKNEG
TKRKTYLIERFKKDECSGHHNTEKNKQGVKESAAILKEDFILTERNILTIDPMIGLSQAD
IDLFFKK
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgacctattacttttcaggcaccattgaccgtgttatttttgaaaataccagcaatttt
tttaaaattattcttctggaaattgacgatactgacagcgattttgatgattttgaaatt
attgtgacaggtactattgctgatgttattgaaggagaaaactatactttttggggtgaa
ttgacccagcatcctaaatatggacagcagttaaaagtggaaagataccagcgtgctaaa
ccctcttctgctggtctgattaagtatttttccagtcagcatttcaagggaatcgggaaa
aaaacagccgaaaaaattattcacttatatggtgatgaccctattgataatattctggaa
gatcctgataagttagaaagcattagtggactttctaaggctaatagagaaaatttagtt
agtaaacttcgtcttaactacggtgctgaacagattctggcaaaattagcagaatatgga
ttaaataacaaaacagctgttcaaatttttgaacgctataaagaagaaagtttgactgtt
attactgaaaatccttatcaactggttgaggacattcaaggcattggattcaaaatggct
gacaaattagcagaacaagtaggtattaacagcgatgctcctcagcgttttcgtgctgct
cttgttcatactcttttagaaacctctattgacaaaggtgacacctatattgaagccaaa
gaattactcgaaaaatctctttttattcttgaagaggtgagacaagtcgaactggatccc
agtcaaattgctcaggaactgacacaattaatctccgaagataaggtacaaaatattggt
actaaaatctttgataatacgcttttttatgccgaatcaggcattcataagcatcttacc
cgcattctggatagaccacttgaaaaagagatcagcagccaagacattcaaactgaaatt
aaacatattcaagcagaatttaatattaactatgacaaagcacaaaaaaatgctatccaa
aaagccatccaaagcaaggttttccttttaacaggcggtccaggaaccggaaaaacgact
gtcatcaatggaattattaaggcttatgctaatttgcatcaaattgacctgcaaaaaagt
gaccgacctattattctggctgccccgactggtcgtgctgctagacggatgaatgagcta
acaggtttacctagtgccaccattcaccggcatttaggacttaatggtgatagtgaatat
caggcacttgatgattttctggattgtgatctcattattattgacgagttttctatggtt
gatacttggctagccaatcaattgtttagtgctattgcttcaaatacacaagttatcatt
gttggtgatagcgatcagctcccatccgtcggtccaggtcaaattttggctgatttactg
aaaataaatagattaccgcaagtttccttaactaaaatattcaggcaatctgaggactca
actattgtcacacttgccaaccagattcgccaaggtcgtcttccaactgacttcacagct
aaaaaggctgaccgttcttattttgaagcacagagcactcacattccgcaaatgattcaa
aagattgtcagttctgcccttaaaagtggtatagatgctcaggaaatacagattttagca
ccgatgtatcgtgggcaagcaggtattacgcatcttaataaactgatgcaagatttgctc
aatcctttaaataaccagttagaatttcaatttaatgaccttcattttcgtaagggcgat
aaagtacttcatcttatcaacgatgcgcaaattaacgtgtttaatggtgacattgggtac
attactgatcttattcctgcaaaatatacagagtccaaacaagatgaaatgattctggat
tttgatggaactgagattaactatcctcgcaatgaatggttgaaaataacactcgcttac
gctatgagtatccacaaatctcaaggcagtgaatttaaagtagttattcttcctgtcaca
cgccaaagcggcagacttttgcaacgcaatctcatttatacagctatcacacgctcaaaa
agcaaacttgtcatgttgggagaaattgcagcctttgacaacgccatcaaaaatgaagga
actaaaagaaaaacttatcttattgaacgctttaagaaggatgaatgcagtggccaccat
aacaccgagaaaaataaacaaggagtaaaagaaagtgcagctatattaaaagaagatttt
attttgacagaaagaaatatcttaacgattgaccctatgattggcttatctcaagctgac
attgacttattttttaagaaataa

DBGET integrated database retrieval system