KEGG   Streptococcus mutans UA159: SMU_1875Help
Entry
SMU_1875          CDS       T00100                                 

Definition
(RefSeq) exodeoxyribonuclease V
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
smu  Streptococcus mutans UA159
Pathway
smu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:smu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SMU_1875
Enzymes [BR:smu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SMU_1875
DNA repair and recombination proteins [BR:smu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SMU_1875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 AAA_11 Viral_helicase1 HHH_5 T2SSE AAA_12 Herpes_Helicase 5_3_exonuc UvrD-helicase PIF1 RsgA_GTPase Helicase_RecD PhoH UvrD_C AAA AAA_16 AAA_22 AAA_29 DUF2075 Zeta_toxin TsaE DEAD NTPase_1 Mei5_like AAA_14 AAA_28 NACHT
Motif
Other DBs
NCBI-GeneID: 1029082
NCBI-ProteinID: NP_722186
UniProt: Q8DSC6
Position
1766522..1768885
Genome map
AA seq 787 aa AA seqDB search
MTYYFSGTIDRVIFENTSNFFKIILLEIDDTDSDFDDFEIIVTGTIADVIEGENYTFWGE
LTQHPKYGQQLKVERYQRAKPSSAGLIKYFSSQHFKGIGKKTAEKIIHLYGDDPIDNILE
DPDKLESISGLSKANRENLVSKLRLNYGAEQILAKLAEYGLNNKTAVQIFERYKEESLTV
ITENPYQLVEDIQGIGFKMADKLAEQVGINSDAPQRFRAALVHTLLETSIDKGDTYIEAK
ELLEKSLFILEEVRQVELDPSQIAQELTQLISEDKVQNIGTKIFDNTLFYAESGIHKHLT
RILDRPLEKEISSQDIQTEIKHIQAEFNINYDKAQKNAIQKAIQSKVFLLTGGPGTGKTT
VINGIIKAYANLHQIDLQKSDRPIILAAPTGRAARRMNELTGLPSATIHRHLGLNGDSEY
QALDDFLDCDLIIIDEFSMVDTWLANQLFSAIASNTQVIIVGDSDQLPSVGPGQILADLL
KINRLPQVSLTKIFRQSEDSTIVTLANQIRQGRLPTDFTAKKADRSYFEAQSTHIPQMIQ
KIVSSALKSGIDAQEIQILAPMYRGQAGITHLNKLMQDLLNPLNNQLEFQFNDLHFRKGD
KVLHLINDAQINVFNGDIGYITDLIPAKYTESKQDEMILDFDGTEINYPRNEWLKITLAY
AMSIHKSQGSEFKVVILPVTRQSGRLLQRNLIYTAITRSKSKLVMLGEIAAFDNAIKNEG
TKRKTYLIERFKKDECSGHHNTEKNKQGVKESAAILKEDFILTERNILTIDPMIGLSQAD
IDLFFKK
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgacctattacttttcaggcaccattgaccgtgttatttttgaaaataccagcaatttt
tttaaaattattcttctggaaattgacgatactgacagcgattttgatgattttgaaatt
attgtgacaggtactattgctgatgttattgaaggagaaaactatactttttggggtgaa
ttgacccagcatcctaaatatggacagcagttaaaagtggaaagataccagcgtgctaaa
ccctcttctgctggtctgattaagtatttttccagtcagcatttcaagggaatcgggaaa
aaaacagccgaaaaaattattcacttatatggtgatgaccctattgataatattctggaa
gatcctgataagttagaaagcattagtggactttctaaggctaatagagaaaatttagtt
agtaaacttcgtcttaactacggtgctgaacagattctggcaaaattagcagaatatgga
ttaaataacaaaacagctgttcaaatttttgaacgctataaagaagaaagtttgactgtt
attactgaaaatccttatcaactggttgaggacattcaaggcattggattcaaaatggct
gacaaattagcagaacaagtaggtattaacagcgatgctcctcagcgttttcgtgctgct
cttgttcatactcttttagaaacctctattgacaaaggtgacacctatattgaagccaaa
gaattactcgaaaaatctctttttattcttgaagaggtgagacaagtcgaactggatccc
agtcaaattgctcaggaactgacacaattaatctccgaagataaggtacaaaatattggt
actaaaatctttgataatacgcttttttatgccgaatcaggcattcataagcatcttacc
cgcattctggatagaccacttgaaaaagagatcagcagccaagacattcaaactgaaatt
aaacatattcaagcagaatttaatattaactatgacaaagcacaaaaaaatgctatccaa
aaagccatccaaagcaaggttttccttttaacaggcggtccaggaaccggaaaaacgact
gtcatcaatggaattattaaggcttatgctaatttgcatcaaattgacctgcaaaaaagt
gaccgacctattattctggctgccccgactggtcgtgctgctagacggatgaatgagcta
acaggtttacctagtgccaccattcaccggcatttaggacttaatggtgatagtgaatat
caggcacttgatgattttctggattgtgatctcattattattgacgagttttctatggtt
gatacttggctagccaatcaattgtttagtgctattgcttcaaatacacaagttatcatt
gttggtgatagcgatcagctcccatccgtcggtccaggtcaaattttggctgatttactg
aaaataaatagattaccgcaagtttccttaactaaaatattcaggcaatctgaggactca
actattgtcacacttgccaaccagattcgccaaggtcgtcttccaactgacttcacagct
aaaaaggctgaccgttcttattttgaagcacagagcactcacattccgcaaatgattcaa
aagattgtcagttctgcccttaaaagtggtatagatgctcaggaaatacagattttagca
ccgatgtatcgtgggcaagcaggtattacgcatcttaataaactgatgcaagatttgctc
aatcctttaaataaccagttagaatttcaatttaatgaccttcattttcgtaagggcgat
aaagtacttcatcttatcaacgatgcgcaaattaacgtgtttaatggtgacattgggtac
attactgatcttattcctgcaaaatatacagagtccaaacaagatgaaatgattctggat
tttgatggaactgagattaactatcctcgcaatgaatggttgaaaataacactcgcttac
gctatgagtatccacaaatctcaaggcagtgaatttaaagtagttattcttcctgtcaca
cgccaaagcggcagacttttgcaacgcaatctcatttatacagctatcacacgctcaaaa
agcaaacttgtcatgttgggagaaattgcagcctttgacaacgccatcaaaaatgaagga
actaaaagaaaaacttatcttattgaacgctttaagaaggatgaatgcagtggccaccat
aacaccgagaaaaataaacaaggagtaaaagaaagtgcagctatattaaaagaagatttt
attttgacagaaagaaatatcttaacgattgaccctatgattggcttatctcaagctgac
attgacttattttttaagaaataa

DBGET integrated database retrieval system