KEGG   Streptococcus mutans UA159: SMU_1940cHelp
Entry
SMU_1940c         CDS       T00100                                 

Definition
(RefSeq) peptidase, AtmC; ArgE/DapE/Acy1 family protein
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
smu  Streptococcus mutans UA159
Pathway
smu00300  Lysine biosynthesis
smu01100  Metabolic pathways
smu01120  Microbial metabolism in diverse environments
smu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SMU_1940c
Enzymes [BR:smu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SMU_1940c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 1029137
NCBI-ProteinID: NP_722244
UniProt: I6L916
Position
complement(1818322..1819695)
Genome map
AA seq 457 aa AA seqDB search
MAFSSEQEQIAKFWQDEVAQHYFEVLRTLISKKSIFAQQIGLQDVAGYLGEIFANVGAEV
TIDETYTAPFVIAKFKSSKPQAKTIIFYNHYDTVPADNDQIWTDNPFKLTLRKGYMYGRG
VDDDKGHITARLTAVRKYIREVGDLPVNVTFIIEGAEESASTDLDKYLKKYADSLLPADV
LIWEQGVKNSQGQLEITGGNKGIITFNLSVSSAEVDIHSKYGAVIESAAWYLLNAISSMR
ADDGQILIDGIYDQVLEPNERELDLVERYALENSEGLRKVYGLKLPTLKKERRDFLKTYF
FEPALSIEGLSSGYQGQGVKTILPSAASAKMEMRLVPGLSPQYVFEKINSHLRKLGFEHV
KVTYTLGEESYRSDMSAPAILTIIDLAKQFYEAGVSVLPTAAGTGPMHTVYDALGIPMLA
FGLGNPNSRDHGGDENVNLADYYTHIELIKELIRSYE
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcattttcaagtgaacaagagcaaattgctaaattttggcaggatgaagttgctcag
cattattttgaggttttacggaccttaatttccaaaaaatctatttttgcacaacagata
ggcctgcaggatgttgcaggctatttgggcgaaatttttgccaatgtcggtgctgaagtg
acaattgatgaaacctatacggctccttttgttattgctaaatttaaaagttccaaacct
caggctaaaaccattattttttataaccattatgatacagtacctgcagataatgatcag
atttggacagataatccctttaaactgaccttaagaaaaggttatatgtatggccgtggt
gttgatgatgacaaagggcatattacagctcgtttgacagctgttcgaaagtatattcgt
gaggttggggaccttcctgttaatgttacttttataatagaaggagctgaagaatctgct
tcaacagatcttgacaagtatttaaaaaaatatgcggatagtttgcttcctgcagatgtt
ttgatttgggaacaaggtgttaaaaatagtcagggtcagttagaaattacaggtggtaat
aaaggtattattacttttaatctttctgtatccagtgcagaggttgatattcactcaaaa
tatggtgcggttattgaatcggcagcatggtatctcttaaatgcaatttccagtatgcga
gcagatgatggtcagattttgatcgatggtatttatgatcaggtcttggagcccaatgag
cgtgaattggatttagtagagcgttatgctcttgaaaatagtgaaggtttgcgcaaagtt
tatggtttaaaattaccaactttaaaaaaagagcgtcgtgattttcttaaaacctatttt
tttgaacccgccttatccatagaaggactttcttctggttatcaagggcaaggtgtgaaa
acaattctgccttctgctgccagtgctaagatggaaatgcgtttagttcccggtctcagt
ccccagtacgtttttgaaaagattaatagtcatttgagaaaattaggctttgaacatgtt
aaggtaacctataccttaggcgaagaatcttatcgcagtgatatgagtgctccggctatt
ttgaccattattgacttggctaagcaattttatgaagctggcgtatctgttctgcccact
gctgctggtacaggtcctatgcatacggtttatgatgctttgggcattcctatgttagct
tttggacttggcaatcccaatagtcgcgatcacggtggtgatgaaaatgttaatttagca
gactattatacccatattgaattaattaaggagttaattagaagttatgagtaa

DBGET integrated database retrieval system