KEGG   Streptococcus mutans UA159: SMU_322cHelp
Entry
SMU_322c          CDS       T00100                                 

Definition
glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
smu  Streptococcus mutans UA159
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:smu00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:smu00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:smu00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:smu00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(305257..306177)
Genome map
AA seq 306 aa AA seqDB search
MPSKKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTG
KSKRSIEDHFDSNFELEYNLEQKGKTDLLKLVNDTTAINLHFIRQSHPRGLGDAVLQAKA
FVGNEPFVVMLGDDLMDITDDKAIPLTRQLMNDYEETHASTIAVMEVPHEDVSAYGVIAP
QGEGVSGLYSVDTFVEKPAPKEAPSNLAIIGRYLLTPEIFTILETQEPGAGNEVQLTDAI
DTLNKTQRVFAREFKGKRYDVGDKFGFMKTSIDYALKHPQVKEDLKAYIIELGKKLDQKS
TQKNSD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgccaagtaaaaaagtcagaaaagctgtcatccctgcggcaggtttaggaacacgtttc
cttcctgctaccaaggctcttgccaaagaaatgctaccaattgttgataaaccaaccatt
cagtttatcgttgaagaagctttaaaatcaggcattgaagacatcctagtggttacaggt
aaatcaaaacgttctattgaagatcattttgattcaaattttgaacttgagtacaatctt
gaacaaaaaggaaaaacagatttacttaaactcgttaatgatactactgcaatcaatctc
cattttatccgtcaaagccatccgcgcgggttaggtgatgctgttcttcaggctaaagcc
tttgtaggtaatgaacctttcgttgttatgctcggtgatgatttgatggatattacagat
gacaaggctatccctttgacacgtcaactcatgaacgattatgaagaaacgcatgcctca
acgattgcagtcatggaggttccccatgaagatgtttctgcctatggtgtaattgctcct
caaggagaaggagttagtggcctttacagtgtcgatacttttgttgaaaagcctgctcct
aaagaagcgcctagcaatctagctatcattggtcgttacttattaacgccggaaattttt
acaattcttgaaacacaagaacccggtgctggcaacgaagttcaattaacagatgccatt
gatactcttaataaaacacaacgtgtttttgcacgtgaatttaagggaaaacgttatgat
gttggtgataaatttggtttcatgaagacttcaattgattatgcacttaaacatccacaa
gttaaagaagatttaaaagcttatattattgaacttggtaaaaaattagaccaaaaatcg
actcaaaagaactcggattaa

DBGET integrated database retrieval system