KEGG   Streptococcus mutans UA159: SMU_322cHelp
Entry
SMU_322c          CDS       T00100                                 

Definition
(RefSeq) glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
smu  Streptococcus mutans UA159
Pathway
smu00040  Pentose and glucuronate interconversions
smu00052  Galactose metabolism
smu00500  Starch and sucrose metabolism
smu00520  Amino sugar and nucleotide sugar metabolism
smu01100  Metabolic pathways
smu01130  Biosynthesis of antibiotics
Module
smu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SMU_322c
   00052 Galactose metabolism
    SMU_322c
   00500 Starch and sucrose metabolism
    SMU_322c
   00520 Amino sugar and nucleotide sugar metabolism
    SMU_322c
Enzymes [BR:smu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SMU_322c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 DUF1079
Motif
Other DBs
NCBI-GeneID: 1029376
NCBI-ProteinID: NP_720776
UniProt: I6L930
Position
complement(305257..306177)
Genome map
AA seq 306 aa AA seqDB search
MPSKKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTG
KSKRSIEDHFDSNFELEYNLEQKGKTDLLKLVNDTTAINLHFIRQSHPRGLGDAVLQAKA
FVGNEPFVVMLGDDLMDITDDKAIPLTRQLMNDYEETHASTIAVMEVPHEDVSAYGVIAP
QGEGVSGLYSVDTFVEKPAPKEAPSNLAIIGRYLLTPEIFTILETQEPGAGNEVQLTDAI
DTLNKTQRVFAREFKGKRYDVGDKFGFMKTSIDYALKHPQVKEDLKAYIIELGKKLDQKS
TQKNSD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgccaagtaaaaaagtcagaaaagctgtcatccctgcggcaggtttaggaacacgtttc
cttcctgctaccaaggctcttgccaaagaaatgctaccaattgttgataaaccaaccatt
cagtttatcgttgaagaagctttaaaatcaggcattgaagacatcctagtggttacaggt
aaatcaaaacgttctattgaagatcattttgattcaaattttgaacttgagtacaatctt
gaacaaaaaggaaaaacagatttacttaaactcgttaatgatactactgcaatcaatctc
cattttatccgtcaaagccatccgcgcgggttaggtgatgctgttcttcaggctaaagcc
tttgtaggtaatgaacctttcgttgttatgctcggtgatgatttgatggatattacagat
gacaaggctatccctttgacacgtcaactcatgaacgattatgaagaaacgcatgcctca
acgattgcagtcatggaggttccccatgaagatgtttctgcctatggtgtaattgctcct
caaggagaaggagttagtggcctttacagtgtcgatacttttgttgaaaagcctgctcct
aaagaagcgcctagcaatctagctatcattggtcgttacttattaacgccggaaattttt
acaattcttgaaacacaagaacccggtgctggcaacgaagttcaattaacagatgccatt
gatactcttaataaaacacaacgtgtttttgcacgtgaatttaagggaaaacgttatgat
gttggtgataaatttggtttcatgaagacttcaattgattatgcacttaaacatccacaa
gttaaagaagatttaaaagcttatattattgaacttggtaaaaaattagaccaaaaatcg
actcaaaagaactcggattaa

DBGET integrated database retrieval system