KEGG   Streptococcus mutans UA159: SMU_330Help
Entry
SMU_330           CDS       T00100                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
smu  Streptococcus mutans UA159
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:smu00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
311576..313033
Genome map
AA seq 485 aa AA seqDB search
MTNKIRVRYAPSPTGLLHIGNARTALFNYLYARHHGGDFIIRIEDTDRKRHVEDGERSQL
ENLRWLGMDWDESPETHENYRQSERLALYKKYIDQLLAEGKAYKSYVTEEELAAERERQE
AAGETPRYINEFLGMSADEKAAYIAKRQAAGIVPTVRLKVNEAGIYKWHDMVKGDIEFEG
GNIGGDWVIQKKDGYPTYNFAVVVDDHDMQISHVIRGDDHIANTPKQLMVYEALGWEAPA
FAHMTLIINSETGKKLSKRDTNTLQFIEDYRQKGYLPEAVFNFIALLGWNPGGENEIFSR
QELIELFDENRLSKSPAAFDQKKLDWMNNEYIKNADFDTIFALAKPYLESAGRLTDKAKK
LVELYQPQMKSIDEIVPLTDLFFEEFPELSEEEKEFMAGETVPIVLQAFKAKLEAMSDED
FKSENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPDTIFLLGKEKSIQHLEDM
LEKLK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacaaaattcgtgtgcgttacgcaccaagtccaacaggattgttacacattgga
aatgcacgtactgcgctctttaattatctctatgcgcgtcatcatggtggcgattttatc
attcgtattgaagatacggaccgtaagcgccatgttgaggatggggaacgctcccagctt
gaaaatctgcgttggttgggcatggattgggatgaaagtcctgaaacgcatgaaaattat
cgtcaatcagaacgtttagcactttataaaaaatacattgaccaactcttggctgaagga
aaagcttataaatcttatgtaacggaagaagaattagctgcagaacgtgaacgtcaagaa
gcagctggtgaaacacctcgctatatcaatgaatttctcggtatgtcagcagatgaaaag
gctgcctacatcgcaaaacggcaagcagctggtattgtgccaacggttcgtttaaaagtc
aatgaagctggtatttataaatggcatgatatggttaaaggtgatattgaatttgaaggt
ggcaatattggtggtgactgggttatccagaagaaagacggttacccaacctataatttt
gccgttgtagtggacgatcatgacatgcaaatttctcatgttattcgtggtgatgaccat
attgccaatacgccaaaacaactcatggtttacgaagcacttggttgggaagcgccagca
tttgctcacatgactcttatcatcaactcagaaacgggaaagaaactatccaaacgtgat
accaataccctacaatttatcgaagattatcgtcagaaaggctatctgccagaagctgtt
ttcaatttcatcgctcttcttggttggaatcctggtggggaaaacgaaattttttcacgt
caagaattgattgaactctttgatgaaaatcgtcttagcaagtcaccagccgcctttgat
cagaagaaattggactggatgaataatgaatacatcaaaaatgccgattttgatacgatt
tttgctttggcaaaaccttatttagaatcagctggtcgtttgacagataaggctaaaaaa
ttggttgagctctatcagccacagatgaaatctattgatgaaattgtgcctttaacggat
cttttctttgaagagtttccagaattgtcagaagaggaaaaagaattcatggctggtgaa
acagttccaattgttctccaagccttcaaggcaaaattggaagccatgtcagatgaagat
ttcaaatcggaaaatatttttccgcaaattaaagccgttcaaaaagaaacgggcatcaag
gggaaaaatcttttcatgccaattcgtattgccgtttcaggtgaaatgcatgggccagaa
ttaccagatacaatcttcttactaggtaaggaaaaatccattcagcatcttgaagatatg
cttgaaaaattgaaataa

DBGET integrated database retrieval system