KEGG   Streptococcus mutans UA159: SMU_478Help
Entry
SMU_478           CDS       T00100                                 

Gene name
kguA
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
smu  Streptococcus mutans UA159
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SMU_478 (kguA)
Enzymes [BR:smu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SMU_478 (kguA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
445886..446518
Genome map
AA seq 210 aa AA seqDB search
MSERGLLIVFSGPSGVGKGTVRQEIFSTPDHQFEYSVSMTTRPQRLGEIDGVDYFFRTRE
EFEELIKQGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIEVQGALQVKQKVPDGVF
IFLTPPDLAELKDRLVGRGTDSQEVIAQRIERAKEEIALMREYDYAVVNDEVKLAAERVK
HIIETEHFRVERVIGRYHKMINEELPLPLR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacgtggtttattaatcgttttttcaggaccttctggtgttggtaaaggaacg
gttaggcaggaaattttttcaacacctgaccatcaatttgaatattctgtttccatgaca
acgcgtccgcaaaggttgggtgaaattgatggtgttgattacttctttcggacacgtgag
gagtttgaagaactcattaaacaaggccaaatgttagagtatgctgagtatgttggtaat
tattatggcacacctttaacgtatgtaaatgaaacattagataaaggaattgatgtcttt
cttgaaatcgaggtacaaggcgctcttcaagttaaacaaaaggttccagacggtgttttt
attttcttaacaccgccggatttagcagaattaaaggatcgattagttggacgtggaaca
gacagtcaggaagtaattgctcaacgcattgaacgtgctaaagaagaaattgccctaatg
cgcgagtatgactacgctgttgtcaatgatgaagtaaaactggcagcagaacgagtcaag
catattattgagacggagcatttccgtgttgaacgtgttattggccgttatcataaaatg
attaatgaagaattgcctttaccccttagataa

DBGET integrated database retrieval system