KEGG   Streptococcus mutans UA159: SMU_537Help
Entry
SMU_537           CDS       T00100                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
smu  Streptococcus mutans UA159
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SMU_537 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMU_537 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SMU_537 (trpB)
Enzymes [BR:smu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SMU_537 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
502728..503939
Genome map
AA seq 403 aa AA seqDB search
MTYNQPNNNGFYGNFGGQFIPETLMTAVIELDEAYREAKADPSFHEELDALLKDYVGRET
PLYFAKRLTDYIGGAKIYLKREDLNHTGAHKINNALGQVLLAKRMGKNKIIAETGAGQHG
VATATAAALFDMECTIYMGEEDVKRQALNVFRMELLGAKVHSVTDGSRVLKDAVNAALRA
WVTNIEDTHYVMGSALGPAPFPEIVRDFQSVIGREAKRQFATVSNGQLPDAVLACIGGGS
NAIGLFYPFVNDESVAMYGAEASGLGLDTDKHAATFAKGRPGVLHGALMDVLQDEHGQIM
EAFSISAGLDYPGVGPEHCYFNEIGRATYDSITDEEALESFKLLSRLEGIIPALESSHAI
ALTQKVAKELGADKSIIVCLSGRGDKDVAQVKERLKQEAKEGK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgacatataatcaacccaataacaacggtttttatggtaattttggaggacaattcatt
cctgaaacgctgatgacagctgttattgaattggatgaggcttatcgtgaagccaaagct
gatcctagttttcatgaagaattagatgctctcttaaaagattatgttggtcgtgaaact
cccttgtactttgctaaacgtttgacggattatattggtggtgccaaaatttatctaaaa
cgtgaagatcttaatcatacaggtgctcacaaaatcaataatgcactggggcaagttctt
ttagctaagcgtatggggaaaaataagattatcgctgaaacaggtgcaggacagcatggt
gttgcaacagcgacagcagcggctctctttgatatggaatgtaccatttatatgggggaa
gaagatgtgaaacgtcaagctcttaatgtctttcggatggagctattaggtgctaaagtg
cattctgttacggatggatcgcgtgtgcttaaagatgcagtcaatgcagctttgcgagca
tgggtaaccaatattgaggatacccattatgttatgggatctgctcttggaccagctcct
ttcccagaaattgttcgtgatttccaatcggttattggcagagaagctaaacgtcaattt
gcgacagtttcaaatggacagctgccagatgcagtcttagcttgtatcggtggcggctcc
aatgcaatcggactcttttatccttttgtcaacgatgaatcagttgccatgtatggtgcg
gaagcgtcaggtttagggcttgataccgataagcatgcggcaacctttgccaaaggacga
ccaggtgttttacatggtgctcttatggatgtgctgcaggatgagcatggacagattatg
gaagctttctcgatttccgcgggccttgactatccaggtgttggtcctgaacactgctat
ttcaatgaaattggacgtgcaacttacgattctattacggatgaagaagctctggaatct
ttcaaattgctatctcgtctggaaggcattattcctgcattagaatctagtcatgcgatt
gctctgacacaaaaagttgcgaaggaactaggagcggataagtccattattgtttgcctc
tcaggacgtggtgataaggatgtggctcaggttaaagaacgtcttaagcaggaagcaaaa
gaagggaagtag

DBGET integrated database retrieval system