KEGG   Streptococcus mutans UA159: SMU_538Help
Entry
SMU_538           CDS       T00100                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
smu  Streptococcus mutans UA159
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SMU_538 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMU_538 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SMU_538 (trpA)
Enzymes [BR:smu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SMU_538 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
503943..504725
Genome map
AA seq 260 aa AA seqDB search
MTKTLTKHLQAIKAEGKGLFIPYIMAGDHDKGLDGLFDTISFLEAQGVSAIEIGIPWSDP
VADGPVIELAGQRSLVKGTSLASIIARLQEKKTQVPLVIMTYFNPVFQYGVETFVADLQN
TSVKGLIIPDLPHEQESFIKPYLENLDLALVPLVSLTTGLERQKELIEDARGFVYAVAIN
GVTGKTGNYRDDLDKHLKHLTEIAQIPVLTGFGVSTLADIKRFNQVSDGVIVGSKIVKGL
HEGMQEEIKDFIYAGSHYQK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacactgacaaagcatttacaagctatcaaggcagaaggcaaaggtcttttt
attccttatattatggctggggatcatgataaaggtttagacggtctctttgataccatt
tcttttttggaagctcaaggtgtatcagccattgaaattggcattccatggtcggatcct
gtggcagatggtcctgttattgaattggctggccaacgtagtttggtaaaggggacatcg
ctggcaagcattattgctaggttacaggaaaagaaaacgcaagtgccacttgttatcatg
acttattttaatcctgtttttcagtatggtgttgaaacatttgttgcagatttgcaaaat
acatctgtcaaaggattgattattcccgatttacctcatgaacaagaaagttttatcaaa
ccttatctggaaaatttagatttagctttagttcctttagtcagcttaacaacaggtcta
gaacgtcaaaaggaactcattgaagatgctcgaggatttgtctacgctgttgctattaat
ggtgttaccggaaaaacagggaattatcgtgatgatttggataaacatttaaaacatttg
acagaaattgctcaaatccctgttttaactggatttggtgtatcaactttagcagatatt
aagcgctttaaccaagtatcagatggtgtcattgttggttcaaaaattgtcaagggatta
catgaaggaatgcaagaagaaataaaagatttcatttatgcaggaagccattatcaaaaa
taa

DBGET integrated database retrieval system