KEGG   Streptococcus mutans UA159: SMU_542Help
Entry
SMU_542           CDS       T00100                                 

Gene name
glk
Definition
glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
smu  Streptococcus mutans UA159
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMU_542 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMU_542 (glk)
   00052 Galactose metabolism
    SMU_542 (glk)
   00500 Starch and sucrose metabolism
    SMU_542 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SMU_542 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SMU_542 (glk)
   00524 Butirosin and neomycin biosynthesis
    SMU_542 (glk)
Enzymes [BR:smu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SMU_542 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
506652..507623
Genome map
AA seq 323 aa AA seqDB search
MAKKLLGIDLGGTSIKFGILTLDGQVQEKWAIETNILEDGKHIVPDIVSSIKHRLELYNL
TKEDFVGIGMGSPGAVDRNLKTVTGAFNLNWAATQEVGTIIEAELGIPFAIDNDANVAAL
GERWVGAGNNNPDVVFVTLGTGVGGGIIADGNLIHGVAGAGGEIGHIIVEPDTGFECTCG
NKGCLETVASATGVVRVARHLAEEYEGISSIKAGIDNGDDVSSKDIFVAAQAGDKFANSV
VEKVTFYLGLATANISNILNPNTVVVGGGVSAAGEFLRSHIESYFKLYAFPQVKQSTKIK
IAELGNDAGIIGAASLAHQFLES
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaaacttttagggattgatcttggtggaacaagtattaaatttgggatttta
actttagatggacaagttcaggagaaatgggctattgaaaccaatattttggaagatggg
aaacatattgttccagatattgtgtcctctatcaagcatcgtttggaactctataattta
actaaggaggattttgttggtattggaatgggatctcctggagctgtggatcgtaatcta
aagactgttacaggtgcttttaatcttaattgggctgctacccaagaggtaggaacaata
attgaagcagaattggggataccatttgctattgataatgatgctaatgttgcagcactt
ggagaacgctgggttggtgcgggtaataataatcctgatgttgtctttgtaacacttggt
acaggtgttggcggcggcattattgctgatggcaatcttattcatggagttgctggtgca
ggtggtgaaattggacatattattgttgagccggatactggttttgagtgtacctgtggc
aataaaggctgtcttgaaacagtggcttcagcaacaggtgtcgtccgtgttgcacgtcat
ttagcagaagaatatgaaggtatttccagtattaaagcgggcattgataatggtgatgat
gtgagcagtaaggatatttttgttgctgcacaggcaggtgataaatttgcaaactcagtt
gttgagaaagttactttctatctaggccttgcaaccgccaatatcagcaatatccttaat
ccaaacacagttgtcgttggaggtggagtatcagctgctggagaattcttgcgctcacat
attgaaagttattttaaattgtatgcttttccacaagtgaagcaatctacaaaaattaaa
attgcagaattaggaaatgacgctggtattattggggcagccagtcttgcacatcagttt
ttagaaagttaa

DBGET integrated database retrieval system