KEGG   Streptococcus mutans UA159: SMU_542Help
Entry
SMU_542           CDS       T00100                                 

Gene name
glk
Definition
(RefSeq) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
smu  Streptococcus mutans UA159
Pathway
smu00010  Glycolysis / Gluconeogenesis
smu00052  Galactose metabolism
smu00500  Starch and sucrose metabolism
smu00520  Amino sugar and nucleotide sugar metabolism
smu00521  Streptomycin biosynthesis
smu01100  Metabolic pathways
smu01110  Biosynthesis of secondary metabolites
smu01120  Microbial metabolism in diverse environments
smu01130  Biosynthesis of antibiotics
smu01200  Carbon metabolism
Module
smu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
smu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMU_542 (glk)
   00052 Galactose metabolism
    SMU_542 (glk)
   00500 Starch and sucrose metabolism
    SMU_542 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SMU_542 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SMU_542 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SMU_542 (glk)
Enzymes [BR:smu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SMU_542 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-GeneID: 1028017
NCBI-ProteinID: NP_720979
UniProt: Q8DVE8
Position
506652..507623
Genome map
AA seq 323 aa AA seqDB search
MAKKLLGIDLGGTSIKFGILTLDGQVQEKWAIETNILEDGKHIVPDIVSSIKHRLELYNL
TKEDFVGIGMGSPGAVDRNLKTVTGAFNLNWAATQEVGTIIEAELGIPFAIDNDANVAAL
GERWVGAGNNNPDVVFVTLGTGVGGGIIADGNLIHGVAGAGGEIGHIIVEPDTGFECTCG
NKGCLETVASATGVVRVARHLAEEYEGISSIKAGIDNGDDVSSKDIFVAAQAGDKFANSV
VEKVTFYLGLATANISNILNPNTVVVGGGVSAAGEFLRSHIESYFKLYAFPQVKQSTKIK
IAELGNDAGIIGAASLAHQFLES
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaaacttttagggattgatcttggtggaacaagtattaaatttgggatttta
actttagatggacaagttcaggagaaatgggctattgaaaccaatattttggaagatggg
aaacatattgttccagatattgtgtcctctatcaagcatcgtttggaactctataattta
actaaggaggattttgttggtattggaatgggatctcctggagctgtggatcgtaatcta
aagactgttacaggtgcttttaatcttaattgggctgctacccaagaggtaggaacaata
attgaagcagaattggggataccatttgctattgataatgatgctaatgttgcagcactt
ggagaacgctgggttggtgcgggtaataataatcctgatgttgtctttgtaacacttggt
acaggtgttggcggcggcattattgctgatggcaatcttattcatggagttgctggtgca
ggtggtgaaattggacatattattgttgagccggatactggttttgagtgtacctgtggc
aataaaggctgtcttgaaacagtggcttcagcaacaggtgtcgtccgtgttgcacgtcat
ttagcagaagaatatgaaggtatttccagtattaaagcgggcattgataatggtgatgat
gtgagcagtaaggatatttttgttgctgcacaggcaggtgataaatttgcaaactcagtt
gttgagaaagttactttctatctaggccttgcaaccgccaatatcagcaatatccttaat
ccaaacacagttgtcgttggaggtggagtatcagctgctggagaattcttgcgctcacat
attgaaagttattttaaattgtatgcttttccacaagtgaagcaatctacaaaaattaaa
attgcagaattaggaaatgacgctggtattattggggcagccagtcttgcacatcagttt
ttagaaagttaa

DBGET integrated database retrieval system