KEGG   Streptococcus mutans UA159: SMU_596Help
Entry
SMU_596           CDS       T00100                                 

Gene name
pmgY
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
smu  Streptococcus mutans UA159
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMU_596 (pmgY)
   01230 Biosynthesis of amino acids
    SMU_596 (pmgY)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMU_596 (pmgY)
  Energy metabolism
   00680 Methane metabolism
    SMU_596 (pmgY)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMU_596 (pmgY)
Enzymes [BR:smu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SMU_596 (pmgY)
Exosome [BR:smu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SMU_596 (pmgY)
  Exosomal proteins of melanoma cells
   SMU_596 (pmgY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
553966..554658
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEEGTQQAIDAGKLIKEADIKFDLAFTSVLTR
AIKTTNLALEYSDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEKFGDEQVHIWRRSYDVL
PPAMAKDDPYSAHTDRRYANLDDTVIPDAENLKVTLERALPYWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKQLSDDDIMGVEIPNFPPLVFEFDENLNVTAEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattagtatttgctcgtcatggtgaatcagaatggaacaaggctaaccttttt
actggctgggctgatgttgacctttcagaagaaggaacgcaacaagcaattgatgccggc
aaactcattaaagaagcagacatcaaatttgaccttgctttcacatcagttttgacacgt
gcaatcaagacaactaatttggcgcttgaatattctgatcaactttgggtaccagttgaa
aagtcatggcgtttgaatgaacgtcactatggtggcttgactggtaaaaataaagctgaa
gctgcggaaaaatttggagacgaacaagttcacatttggcgtcgctcatatgatgtattg
ccgccagctatggccaaagacgatccatactcagcacacactgaccgtcgttatgcaaat
cttgatgatactgttattccagatgcagaaaacttaaaagtcaccttagaacgtgctctt
ccatactgggaagataaaattgctccagctcttaaagatggaaaaaatgtatttgttgga
gcacatggtaactctatccgtgctcttgtaaaacatatcaaacaattgtcagatgatgac
attatgggtgttgaaattccaaacttcccaccattagtttttgaatttgacgaaaattta
aatgtcactgctgaatactatcttggtaaataa

DBGET integrated database retrieval system