KEGG   Streptococcus mutans UA159: SMU_598Help
Entry
SMU_598           CDS       T00100                                 

Gene name
recM
Definition
(RefSeq) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
smu  Streptococcus mutans UA159
Pathway
smu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:smu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SMU_598 (recM)
DNA repair and recombination proteins [BR:smu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     SMU_598 (recM)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SMU_598 (recM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH IMS_HHH HHH_8 Coq4 HHH_5 Pox_Rap94
Motif
Other DBs
NCBI-GeneID: 1028050
NCBI-ProteinID: NP_721031
UniProt: Q8DV99
Position
556993..557592
Genome map
AA seq 199 aa AA seqDB search
MLYPTPIAKLIESFTKLPGIGIKTATRLAFYTIGMSDEDVNNFAKNLLAAKRELTYCSVC
GNLTDDDPCNICTDESRDRSTVLVVEDSKDVSAMEKIQEYHGLYHVLHGLISPMNGIGPD
DINLKSLLTRLRDNSDIHEVIIATNATADGEATAMYISRVLKPAGITVTRLARGLAVGSD
IEYADEVTLLRAIENRTEL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgctctacccaacgcctattgccaaacttattgagagcttcacaaaattaccgggtatt
ggtatcaaaacagcgactcgcttagctttttatacgattggtatgagtgatgaagacgtt
aataactttgctaaaaatcttctagctgctaaacgagaattgacctactgttctgtttgt
ggcaatctgacagatgatgatccttgcaatatttgtacagatgaaagcagagaccgctcg
actgttttagtagttgaagatagtaaggatgtttctgcaatggaaaaaattcaggaatat
catggtctttatcatgttttacacggcctgatttctcctatgaatggtattggtcctgat
gatattaatttgaaaagtcttctgacacgcctacgtgataatagtgatattcatgaagtc
attatcgcaactaatgccacagcagatggagaagcaacggctatgtatatttccagagtt
ctcaaacctgctggtattacagttacacgtttagcgcgtgggcttgctgttggttctgac
attgagtatgctgatgaagtaactctgcttcgagcaattgaaaacaggacagagttataa

DBGET integrated database retrieval system