KEGG   Streptococcus mutans UA159: SMU_70Help
Entry
SMU_70            CDS       T00100                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
smu  Streptococcus mutans UA159
Pathway
smu00260  Glycine, serine and threonine metabolism
smu00750  Vitamin B6 metabolism
smu01100  Metabolic pathways
smu01110  Biosynthesis of secondary metabolites
smu01120  Microbial metabolism in diverse environments
smu01230  Biosynthesis of amino acids
Module
smu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMU_70 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SMU_70 (thrC)
Enzymes [BR:smu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SMU_70 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 1029655
NCBI-ProteinID: NP_720550
UniProt: Q8DWH9
Position
69631..71115
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDENNKVSASLAILQGLARDGGLFTPTSYPQVDLDFDQLKTASYQEVAKLVL
SAFLDDFTEAELDYCIANAYDDKFDTPVIAPLVKLNGQYNLELFHGSTIAFKDMALSILP
YLLTTSAKKQGINNKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPNGGVSKIQELQMT
TQVGDNTHVVAIEGNFDDAQTNVKKMFNDSDLRTKLLEHGAQFSSANSMNVGRLVPQVVY
YVYAYAQLLKSGDIKNGDRVNFTVPTGNFGNILAAYYARQIGVPIGKLICASNENNVLTD
FFKTGTYDKKREFRVTTSPSMDILVSSNLERLIFHLLGNDSVKTKELMQALIEKGEYTLE
KADKAILDLFAAGFATEEETAAEIKRVYTASRYIEDPHTAVASAVYHAYRKSSGDQSPTV
IASTASPYKFPRVVVSAVGGKDPKDDFAAVRELSRLSGVSVPRAVDGLETAEVRHRKVVA
TADMQKAVESYLGI
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacattagtgtatcaatcaacccgtgatgaaaataataaagtaagcgccagtctggct
attttgcaaggcttagcaagagatggcggtctttttacgccgacatcttatccacaagtt
gatttggattttgaccagcttaaaacggcttcctaccaagaagttgccaagttggtttta
tcagcttttttggatgattttacagaagcagaattggattattgtattgctaatgcctat
gatgataagtttgatacaccggtcattgcgcctttagttaaacttaatggccaatataat
cttgaactttttcatggttcaactattgcctttaaggatatggcgctttcgattttgcct
tatcttttaacaacgtcagctaaaaagcaaggcattaataacaagatcgtcattttaaca
gcgacatctggagatactggtaaggcagctatggcaggctttgcggatgttccggggaca
gaaattattgtcttttatcctaatggtggtgtcagtaagattcaagaattacaaatgacg
acacaggtaggagataatacacatgttgttgctattgaaggaaactttgatgatgctcag
acaaatgtcaaaaagatgttcaacgatagtgatctgcgaacaaaacttttagagcacggt
gcccaattttcatcggcaaactctatgaatgtcggacgtttagtgccacaagtggtttac
tacgtttatgcttatgcccagttgcttaaatcaggtgacattaaaaacggtgatagggtt
aactttacagtaccaacgggaaattttggaaatattttggctgcttattatgcacgtcaa
attggtgtgccaattggcaaacttatctgtgcttcaaatgaaaataatgttttgactgac
ttctttaaaacagggacttatgataagaaaagagaatttcgtgtaacaaccagtccctca
atggacattcttgtttcatctaatttggaacgccttatttttcatcttttgggaaatgat
tctgttaaaacaaaagaactcatgcaggctttgattgaaaagggtgagtatactttagaa
aaagctgataaagctattttagatttatttgctgcgggatttgcgaccgaagaagagaca
gccgctgagattaaacgtgtttataccgcttcgcgttatattgaagatccgcatacagca
gttgcttcggctgtttaccatgcttataggaaatctagtggtgatcaaagcccaactgta
atagcttcaacagctagcccttataaatttccgcgtgtcgttgtttctgcagtcggaggt
aaagatccaaaagatgattttgcagctgtacgtgagctgagtcgtttatcaggtgtatca
gtgccaagggcagttgatggccttgaaactgctgaagttcgtcatcgaaaggttgtcgcg
acagctgatatgcaaaaagcagtagagtcatatttaggaatttaa

DBGET integrated database retrieval system