KEGG   Streptococcus mutans UA159: SMU_715Help
Entry
SMU_715           CDS       T00100                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
smu  Streptococcus mutans UA159
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMU_715
   01230 Biosynthesis of amino acids
    SMU_715
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMU_715
   00051 Fructose and mannose metabolism
    SMU_715
   00562 Inositol phosphate metabolism
    SMU_715
Enzymes [BR:smu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SMU_715
Exosome [BR:smu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SMU_715
  Exosomal proteins of bladder cancer cells
   SMU_715
  Exosomal proteins of melanoma cells
   SMU_715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
674360..675118
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKMNKTAAEAREFIDAVKNNIPSNNLVDTVIGSPALFLEGMKKGVKGTEL
QVAAQNCYWEDFGAFTGETSPAALAALGVDYVIIGHSERRDYFHETDQEINKKAHAIFKH
KMTPILCCGESLETYEAGKTAEWIEGQITADLKGLSAEQVSSMVIAYEPIWAIGTGKSAD
ANIADDICGVVRATVEKLYGKEVAQAVRIQYGGSVKPENVAEYMAKENVDGALVGGASLQ
ADSFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaattattgctggtaactggaaaatgaacaagactgctgctgaagcg
cgtgagttcattgatgcagttaagaacaatattccttcaaataatcttgttgatactgtt
attggatcacctgcattattccttgaaggaatgaaaaaaggcgtgaaaggtacagaattg
caagttgcagctcaaaactgttactgggaagattttggtgcttttactggtgaaacaagt
cctgcagcgcttgcagcacttggtgttgactatgttattattgggcactcagaacgtcgt
gattacttccatgaaacagatcaagagattaacaaaaaagcacatgctatttttaagcac
aagatgacgccaattctttgttgtggtgaatctcttgaaacttatgaagcaggtaaaaca
gctgaatggattgaaggacaaatcactgctgaccttaaaggtttgagtgctgagcaagta
tcaagtatggttatcgcttatgaaccaatctgggctattggtactggtaagtcagctgat
gctaatattgcagatgatatctgtggtgttgttcgtgcaaccgttgaaaaactttatgga
aaagaagttgctcaggctgtccgtattcaatacggcggttctgtaaaaccagaaaatgtt
gcagaatacatggctaaagaaaatgttgatggtgctcttgttggcggtgcttcactgcaa
gcagacagtttccttgcccttcttgactttgtcaaataa

DBGET integrated database retrieval system