KEGG   Streptococcus mutans UA159: SMU_715Help
Entry
SMU_715           CDS       T00100                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
smu  Streptococcus mutans UA159
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMU_715
   01230 Biosynthesis of amino acids
    SMU_715
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMU_715
   00051 Fructose and mannose metabolism
    SMU_715
   00562 Inositol phosphate metabolism
    SMU_715
Enzymes [BR:smu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SMU_715
Exosome [BR:smu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SMU_715
  Exosomal proteins of bladder cancer cells
   SMU_715
  Exosomal proteins of melanoma cells
   SMU_715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
674360..675118
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKMNKTAAEAREFIDAVKNNIPSNNLVDTVIGSPALFLEGMKKGVKGTEL
QVAAQNCYWEDFGAFTGETSPAALAALGVDYVIIGHSERRDYFHETDQEINKKAHAIFKH
KMTPILCCGESLETYEAGKTAEWIEGQITADLKGLSAEQVSSMVIAYEPIWAIGTGKSAD
ANIADDICGVVRATVEKLYGKEVAQAVRIQYGGSVKPENVAEYMAKENVDGALVGGASLQ
ADSFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaattattgctggtaactggaaaatgaacaagactgctgctgaagcg
cgtgagttcattgatgcagttaagaacaatattccttcaaataatcttgttgatactgtt
attggatcacctgcattattccttgaaggaatgaaaaaaggcgtgaaaggtacagaattg
caagttgcagctcaaaactgttactgggaagattttggtgcttttactggtgaaacaagt
cctgcagcgcttgcagcacttggtgttgactatgttattattgggcactcagaacgtcgt
gattacttccatgaaacagatcaagagattaacaaaaaagcacatgctatttttaagcac
aagatgacgccaattctttgttgtggtgaatctcttgaaacttatgaagcaggtaaaaca
gctgaatggattgaaggacaaatcactgctgaccttaaaggtttgagtgctgagcaagta
tcaagtatggttatcgcttatgaaccaatctgggctattggtactggtaagtcagctgat
gctaatattgcagatgatatctgtggtgttgttcgtgcaaccgttgaaaaactttatgga
aaagaagttgctcaggctgtccgtattcaatacggcggttctgtaaaaccagaaaatgtt
gcagaatacatggctaaagaaaatgttgatggtgctcttgttggcggtgcttcactgcaa
gcagacagtttccttgcccttcttgactttgtcaaataa

DBGET integrated database retrieval system