KEGG   Streptococcus mutans UA159: SMU_871Help
Entry
SMU_871           CDS       T00100                                 

Gene name
pfkB
Definition
fructose-1-phosphate kinase
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
smu  Streptococcus mutans UA159
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SMU_871 (pfkB)
Enzymes [BR:smu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     SMU_871 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
818491..819402
Genome map
AA seq 303 aa AA seqDB search
MIYTVTLNPSIDFIVRIDSVKIGSVNRMDSDDKFVGGKGINVSRILKRLGQDNTATGFIG
GFTGRFVEEGLIAEGIKTNFVHVNQDTRINVKIKADQETEINGTGPVITKEQVLALENIL
QQLSQDDTVVFAGSAPSNLGNQIYERLIPLVRQTGAQIVCDFEGQTLLDALDYQPLLVKP
NNHELEAIFKVNLNGITDVEKYARQILAKGAQNVIISMAGDGALLVTSDATYFAKPIKGQ
VRNSVGAGDSMVAGFTGEFVKSANPLEALKWGVACGTATAFSDDLASIDFIKETYEKVEV
EKL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacggtaacccttaatccttctattgattttatcgttcgtattgatagtgta
aaaatcggcagtgtcaatcgtatggatagtgacgataaatttgttggaggtaaagggatt
aatgttagtcgtattcttaagcgtttaggacaggataatacggcgacaggttttattggc
ggttttactggtaggtttgttgaggaaggattgattgctgaaggaatcaagactaacttt
gtccatgttaatcaagataccagaattaatgtcaaaattaaggctgatcaagaaactgaa
attaatggtacaggccctgtcattacaaaagaacaagttttagctttagagaacatctta
cagcaactttcacaagacgatacagttgtttttgcaggcagtgcaccgtccaatttagga
aaccaaatttatgaacgcttgattccgttggtgagacaaacaggagcgcaaattgtttgc
gattttgaagggcaaactttattggatgctcttgactatcaaccgcttttggttaaacca
aataatcatgaacttgaagctattttcaaggtaaacttaaacggtattactgatgttgaa
aagtatgcccgccaaattcttgctaaaggcgcacaaaacgtcattatttcaatggcagga
gatggcgctttattagtaacatcagatgcgacttattttgctaaaccgattaagggacag
gtcagaaattctgtcggtgctggtgattcaatggttgctggttttactggtgaatttgtt
aagtcagctaatcctcttgaagctctcaaatggggagtggcttgcggtacagcaaccgct
ttttcagatgatttagccagtattgattttataaaagaaacatatgaaaaagtagaggta
gaaaaattatga

DBGET integrated database retrieval system