KEGG   Streptococcus mutans UA159: SMU_877Help
Entry
SMU_877           CDS       T00100                                 

Gene name
agaL
Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
smu  Streptococcus mutans UA159
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SMU_877 (agaL)
  Lipid metabolism
   00561 Glycerolipid metabolism
    SMU_877 (agaL)
   00600 Sphingolipid metabolism
    SMU_877 (agaL)
Enzymes [BR:smu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SMU_877 (agaL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
828355..830517
Genome map
AA seq 720 aa AA seqDB search
MGIVIKDNLFYIHTKDSSLIIEERDGDLLLKHLGKKIEAYHFSNTVFEKDHAFSANPVAD
NRNYSYDTQRQIFGVHGFGDFRVPSLILQHDNNDLTRFKFKKAKIIKGGIKARGLPNPHS
SESAQSLALILEDDLAKLRMTLYYTAYDDNATISTFVKFENLSDKPVILHRALSTMFDLP
ASHYDVITFQGAYAREKTLRRHQIEQGLFKIGSNRGASGHAQTPSLILTEHDSNEFYGEA
LALQLIYSGNFQAFVQKNQLNEVRLGIGINDDNFSWDLQANQSFETPVALITYTDKGLTD
LTQESHNFIKRHIIPKNFANKERPILINNWEATYFDFNRSQLLGLADEARKLGIELFVLD
DGWFGHRFDDNSSLGDWFVNEEKLGGSLDSFIKEIHDRGLQFGLWFEPEMVSVDSKLYRA
HPDWVIQADQREHTYSRNQLVLNLANPDVVAYIKTVLDKLLTENTIDYVKWDYNRNITNI
GNGRTYLETQMQSHAYILGLYNIVSYLTTKHDKVLFESCSGGGGRNDLGMMCYFPQVWSS
DNTDAIARLPIQYGSSYLYPTISMGAHVSAVPNHQMNRHTPLTTRGHVAMMGNLGYELDL
AILTKNEKKAVANQIKHYKKIRSVVQFGKLYRLINPEVGINEVAVQYTYDNQVLVTYVRI
QSTIEMMETTVKLRGLDADAIYVLIETGQIFSGAELMYAGLTIDMPQGDYLSKQYYFIKK
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgggcattgttattaaagataaccttttttatatacacaccaaagactcatcattgatt
attgaagaaagagatggtgatttgcttttaaaacatctaggtaaaaaaattgaagcctat
catttttccaatactgtttttgaaaaggatcatgctttttcagctaatccagtggcggac
aatagaaattatagttatgatacacaaagacaaatatttggtgttcatggttttggtgat
tttagagtgccttcactaatccttcaacatgataataatgatttaacacggtttaaattt
aagaaggctaaaattattaagggggggatcaaggcaagaggtttgcctaatccacatagc
agtgagagtgctcaaagcttggctcttatcttagaagatgatttggcaaaactgcgcatg
actctgtattatacggcttatgatgataatgccaccatttcaacctttgtcaaatttgaa
aatttatctgataagcctgttattcttcatcgtgctttatcaacaatgtttgatttacct
gccagccattatgatgtgataacttttcaaggagcttatgctcgcgagaagacgcttcgg
cgccaccagattgaacagggtctgtttaaaataggctctaatcgaggagcttcaggacat
gctcaaaccccttccttaattttaacagagcatgatagcaatgagttttatggagaggct
ttggctttacaattaatctatagcggaaattttcaagcttttgttcaaaaaaatcaatta
aacgaggttcgcttaggcatcggaataaatgatgataatttttcatgggacctgcaggct
aatcagagttttgagacacctgtagctttgataacctacactgataagggattaacggat
ctgacacaagaaagtcataattttattaaacgtcatattattcctaagaattttgctaat
aaggaacgtcctatccttatcaataattgggaggcaacatattttgattttaatcggagt
caattgctggggctggcagatgaagccagaaaacttggcattgaactctttgtgcttgac
gatggttggtttggtcatcgttttgatgacaatagctcacttggtgattggtttgtcaat
gaagaaaaacttgggggttcccttgatagctttatcaaggaaattcatgatagaggatta
cagttcggcctttggtttgaaccagaaatggtatcagttgacagcaaactttatagagct
catcctgattgggtcattcaggcagatcagcgagagcatacttattctcgcaatcaattg
gtcttgaatctagctaatcccgatgtagttgcttatatcaaaactgttcttgataagctg
ctgacagaaaatacgattgattatgttaaatgggactacaatcgcaatataaccaatatt
ggcaatggcagaacttacttggaaacgcaaatgcagtcgcatgcttatatactggggttg
tataatattgtttcttacttaacaacaaaacacgataaggtcttgtttgaatcctgttca
ggaggtggcggtcgcaacgatttggggatgatgtgttattttcctcaagtgtggtcaagt
gataatacagatgctattgcaagactgcctatacagtatggttcctcttatctttaccca
actatttctatgggagctcatgtttcagcggttcctaaccatcaaatgaaccgtcatacc
cctcttacaacacgaggtcatgttgctatgatgggaaatttaggttatgaattggactta
gcaatcttaaccaaaaatgaaaaaaaggctgttgccaatcagattaaacattataaaaag
ataaggtctgttgtacaatttggcaagctttaccgtctaattaatcccgaagttggaatt
aatgaggtagcagtgcaatatacctatgacaatcaggtactggttacctatgtccgtatt
caatcaaccatagagatgatggaaacaactgtaaagttgaggggactagatgcagatgcc
atttatgttcttatagaaactggacaaatcttttcaggtgcggagttaatgtatgcggga
ttgaccattgatatgccgcaaggtgattatttgagtaaacaatactattttattaaaaag
tag

DBGET integrated database retrieval system