KEGG   Streptococcus mutans UA159: SMU_968Help
Entry
SMU_968           CDS       T00100                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
smu  Streptococcus mutans UA159
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SMU_968
Enzymes [BR:smu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SMU_968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
916041..916619
Genome map
AA seq 192 aa AA seqDB search
MNEKIMSDQKKIEEAVYQLLEALGEDPNREGLLDTPKRVAKMYQEMFAGLNEDPKDQFTA
VFSEEHEDVVLVKDIPFYSMCEHHLVPFHGLAHVAYIPSDGCVTGLSKLARAVEVVSKRP
QLQERLTVQIANALEEALKPKGVLVMIEAEHMCMTMRGIKKPGSKTVTRVVRGICQSDKE
TRQEIIAMIHHN
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagaaaataatgtcagaccaaaaaaagattgaagaagccgtttatcagttgtta
gaagcacttggtgaagaccctaatcgtgagggactgttggatacgccaaagcgtgttgct
aagatgtatcaggaaatgtttgcaggtcttaatgaggatcctaaagaccagtttacagct
gttttttctgaagaacatgaagacgttgttttagtcaaggatatcccattttattctatg
tgtgagcatcatttagtcccttttcacggcttagcacatgttgcctatattccgagtgac
ggctgcgtcacaggacttagtaaattagctcgtgctgttgaggtggtcagcaaacgcccg
cagctgcaggagcgactgacagttcaaatagctaatgctcttgaggaagccttaaagcct
aaaggtgttcttgttatgattgaagcagagcacatgtgcatgactatgagaggaatcaaa
aagcctggcagcaaaactgtaaccagagttgttagaggtatttgccaatctgataaagaa
acgcgtcaggaaattatagcaatgatacatcataactag

  All links  
No link information was found.   
DBGET integrated database retrieval system