KEGG   Streptococcus mutans UA159: SMU_969Help
Entry
SMU_969           CDS       T00100                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
smu  Streptococcus mutans UA159
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:smu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
916629..917429
Genome map
AA seq 266 aa AA seqDB search
MKIGKYDVAGKAAIMGILNVTPDSFSDGGQYETIDQALKQVEAMLAAGAAIIDIGGESTR
PGAAFVSAEDEIKRIVPIVEAISEKFNCLISIDTYKTETARVALAAGAHILNDVWSGLYD
GQMFQLAAETGAPIILMHNQCEEVYGNVTEDVCQFLLERADLAQKTGVKKENIWLDPGFG
FAKNVEQNMELLRGLAEVTKLGYPVLFGISRKRVVDSLLGGHTKPQERDMATAALSGYAI
SKGCKIVRVHNVAANKDIVKVSSQLA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggtaaatatgatgtagctggtaaagcagctattatggggattctcaatgta
accccagattcattttcagatggcggacaatacgaaacaatcgatcaggctctaaaacag
gttgaagccatgttggcagcaggagcggctatcattgatatcggcggagaatccacacgt
cccggcgcagcatttgtttctgctgaggatgaaattaaacggattgttccaattgttgaa
gctattagcgaaaagtttaactgcctgattagcattgatacctataagactgagactgct
cgagtagcccttgctgcgggagcgcacatcttaaatgatgtgtggtctggtctttatgat
gggcaaatgtttcaattagcagctgaaactggagcgcctattattttgatgcacaatcag
tgtgaagaagtttatggcaatgtgacagaagatgtttgccaattcttgctggaacgtgct
gatttagcccaaaaaacaggagttaaaaaagaaaatatttggcttgatcctggttttggt
ttcgctaaaaatgtcgaacaaaacatggaacttctacgaggcttagcggaggtgactaag
cttggttatcctgttttatttggtatttctagaaaacgtgttgttgatagtttgttaggc
ggtcataccaagccgcaagagcgagacatggcgacagcggctctttctggctatgccatt
agtaagggctgcaaaattgttagagtacataacgtggctgccaacaaagacattgtaaag
gtcagcagccagttagcatga

DBGET integrated database retrieval system