KEGG   Streptococcus mutans UA159: SMU_985Help
Entry
SMU_985           CDS       T00100                                 

Gene name
bglA
Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
smu  Streptococcus mutans UA159
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:smu00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
929971..931410
Genome map
AA seq 479 aa AA seqDB search
MMSYTFPENFLWGGATAANQFEGAYNQDGKGLSVQDVTPKGGVTQSGSSSPLITEKPTED
NLKLVGIDFYNRYKEDIALFAEMGFKVFRLSIAWTRIFPNGDDLEPNEAGLAFYDKVFDE
LAKYDIEPLVTLSHYETPLHLARKYNGWANRELIAFYERYARTVFTRYKDKVKYWLTFNE
VNSVLHAPFMSGGIITDPEQLSKQDLYQAVHHELVASALATKVGHEINPDFKIGCMVLAM
PAYPMPADPLDQLAVREFENQNYLFSDLHARGKYPNYIKRYFKDNNIDIQMAEGDKELML
ENTVDFISFSYYMSVAAAHNPEDYNSGRGNVLGGLSNPYLQASEWGWQIDPVGLRLVLND
FYDRYQLPLFIVENGLGAKDVLVQGPDGPTVEDDYRIDYLQKHLMQVGEALQDGVDLLGY
TTWGPIDLVSASTAELSKRYGFIYVDRNDDGSGSLVRYKKKSFAWYKKVIETNGASLYE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcatacacatttccagaaaattttttatggggtggtgcaacagctgccaatcag
tttgaaggtgcttataatcaagatggtaagggcttatccgttcaagatgttacgccaaaa
ggaggagttactcaatctggttcttcaagtccattgattactgaaaaaccaacggaagat
aaccttaaattagttggtattgatttttataatcgttataaagaagatattgctcttttt
gctgaaatgggttttaaggtatttcgtctttctattgcctggactcgtatctttccaaat
ggtgatgatctagaaccaaacgaagccggacttgccttttatgataaagtttttgatgaa
ctggcaaaatatgatattgaaccattggttaccttatcgcattatgaaacacctcttcat
ttggctagaaaatataatgggtgggcaaatcgtgagttaattgctttttatgaacgttat
gcacgcacagtattcacacgttataaagataaggtgaaatattggctaacttttaatgaa
gtcaattctgttttacatgcgccgtttatgtcaggaggtatcattaccgatcccgaacaa
ttaagcaaacaagatctttatcaagccgttcatcatgaattagtggcatctgctcttgca
actaaagttggtcatgaaatcaatccggattttaaaattggctgtatggttcttgctatg
cctgcttatccaatgcctgcagatccattagatcaattagctgttcgagagtttgaaaat
caaaattatctatttagtgacttacatgcacgagggaaataccctaactatattaaacgt
tatttcaaggacaataatattgacattcaaatggctgaaggtgacaaggagctaatgctc
gaaaatactgttgattttatttctttctcttactatatgtcagtagcagcagctcataat
cctgaagactacaattcaggaagaggtaatgtcttgggaggtctttcaaatccttatctt
caagcttcagaatggggttggcaaattgatcctgttggtttacgtctagttcttaatgac
ttttatgatcgttatcaattaccactctttattgtagaaaatggtctaggtgccaaagat
gttcttgttcaaggaccagatggaccgaccgttgaagacgattaccgtattgattatctt
caaaaacacttgatgcaagtaggagaagccctgcaagatggtgtagacttacttggttat
acaacttgggggccaatagatcttgtttctgcatcaactgcagaacttagtaaacgctat
ggttttatctatgttgatcgcaacgatgatggttctggaagtttggtacgctataagaaa
aaatcatttgcttggtataaaaaggttattgaaactaatggtgccagcctctatgaatga

DBGET integrated database retrieval system