KEGG   Streptococcus mutans GS-5: SMUGS5_00630Help
Entry
SMUGS5_00630      CDS       T02185                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
smut  Streptococcus mutans GS-5
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smut00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SMUGS5_00630
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMUGS5_00630
   00620 Pyruvate metabolism
    SMUGS5_00630
   00650 Butanoate metabolism
    SMUGS5_00630
  Lipid metabolism
   00071 Fatty acid degradation
    SMUGS5_00630
  Amino acid metabolism
   00350 Tyrosine metabolism
    SMUGS5_00630
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SMUGS5_00630
   00626 Naphthalene degradation
    SMUGS5_00630
Enzymes [BR:smut01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SMUGS5_00630
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SMUGS5_00630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
147477..150146
Genome map
AA seq 889 aa AA seqDB search
MAKETKTEALTAEEAAKQYTNSLVEKALKAEKVYATYTQEQVDKIVAAMALAGSEASLQL
AKEAHEETGRGVVEDKDTKNHFATEYVYERIKNEKTVGIIGEDKVAGSIEIAAPLGVLAG
IVPTTNPTSTTMFKILVALKTRNAIVFAFHPAAQKCSAHAAQILYDAAVKAGAPENIVQW
IETPSIANTGALISNKGIASILATGGPGMVNAALKSGNPSMGVGAGNGAVYVDATANLER
AVEDLLLSKRFDNGMICATENSAVVEAPIYKEWLAKMQEKGAYLVPKKDYKKFEDFVFND
NHGVNGPVAGMSAKWICEQAGVTLPEGKDVLLFELDKKKIGEKLSSEKLSPLLSVYKAKD
RKDGIDIVAALLDYQGAGHNCAIQIGSQADPFVAEYGDALNSSRVLVNQPDSVGGIGDVY
TDALQASLTLGTGSWGKNSLSHNLSTGDLLNVKTVAKRRNRPQWVRLPEKTYYEKNAISY
LQDETETMTRAIIVADPGMLQFGFVDTVLAQLSLRDEKVATSIYGTIKPDPTLGQTIEIA
RQMRDFKPDTVIAVGGGSALDAAKIARYIYEYSLDQEADFLDSYEKVSELFLELQQKFID
IRKRIVRFKHQTVTRLFCIPTTSGTGSEVTPYAVITDDFTHVKYPLTDYELTPQVAIVDP
EFVMTVPKRTVALSGLDTLSHALESYVSVMASDFTRPWSMEAIRLVIENLEDSYNFDPKN
PTLRGEQARENMHYAATLAGMAFSNAFLGINHSLAHKTGGEFGLPHGLAISIAMQHVIRY
NGVAGNVKRSVYPRYEEYRAQRDYADIARALGLKGKDDAELVEALCARIDQLMHAVDVEP
KLSANGVTKKAFDAAVDRLASLAYDDQCTPANPRQPYIEEMKQLLIDQF
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaacaaaaacagaagcactcactgctgaagaagcagctaagcagtatacg
aatagcttagttgaaaaagcgttaaaggctgaaaaagtttatgcaacttatacacaagaa
caggtagataaaattgttgcagctatggcgcttgctggttctgaggcgtccctgcagtta
gctaaagaagctcacgaagaaacaggccgtggggttgtcgaagataaagatactaaaaac
cactttgcgacagaatatgtatatgaacgcataaaaaatgaaaaaacggttggcatcatt
ggtgaagataaagttgctggcagtatcgaaattgcagcaccacttggtgtcttggcaggt
atcgtaccaacaactaacccaacatcaacgactatgtttaaaatcttagtcgcattgaaa
acacgcaatgcaatcgtctttgctttccacccagcagctcaaaaatgttctgctcatgcc
gcccaaatcttgtatgacgcggcggttaaagccggcgctcctgaaaatattgttcaatgg
attgaaacaccatccatcgcaaacacgggagctttgatttccaacaaaggcattgcttca
atccttgcaactggcggacctggcatggttaatgcagcccttaaatctggtaatccatcg
atgggtgttggtgcaggtaatggtgctgtttatgtggatgcaactgctaatcttgaacgt
gcggttgaagaccttcttctttctaagcgttttgacaatggtatgatttgtgcgactgaa
aactcggcagttgtggaagcacctatttataaagaatggcttgctaaaatgcaggaaaaa
ggcgcttaccttgttcctaaaaaagattacaaaaaatttgaagattttgtctttaatgac
aaccatggtgttaacggaccggttgctggtatgtcggcgaaatggatctgtgaacaagcc
ggtgtgacattgccagaaggcaaagatgttctcttgtttgaacttgataagaaaaaaatt
ggtgagaaattatcatcagaaaaactctctccgcttctttctgtttataaagccaaagat
cgcaaagatggtattgatattgtagcagcccttcttgattaccaaggtgctggtcataac
tgtgctatccaaatcggttcacaagctgacccatttgtcgctgaatatggagatgccctc
aattcatctcgtgttttggttaaccaaccagactcagtcggtggtatcggtgacgtttat
acagacgcattgcaagccagcttaactcttggaacaggatcatgggggaaaaattcattg
tcacacaacttatcgactggcgacctcttgaatgtgaaaactgttgcgaaacgccgcaac
cgtcctcaatgggttcgtttaccagaaaaaacttactacgaaaaaaatgctatttcatac
ttgcaggatgaaactgaaacaatgacgcgtgctatcatcgttgccgacccaggtatgctt
caatttggttttgttgacactgtccttgctcagctatcccttcgggatgaaaaagtggca
acttcaatttatggtactatcaaaccagatccaacactcggtcagactattgaaattgct
agacaaatgcgtgacttcaaaccagatactgttattgcagttggtggcggttctgccctt
gatgcagccaaaattgcgcgttatatctatgaatattcgttggatcaagaagcagatttc
cttgatagttatgaaaaagtcagtgagctcttccttgaattgcagcaaaaattcattgat
attcgtaagcggattgttcgcttcaagcatcagacagtgactcgtctcttctgtatccca
acaacatctggtacgggttcagaagtgacaccttatgccgttattactgatgatttcaca
cacgtgaaatacccattgactgattatgaattgacaccgcaagttgctattgttgatcca
gaatttgtcatgacagtgcctaaacgtacagtagctctttcaggacttgatactttgtca
catgctcttgaatcttacgtatctgttatggcatctgatttcacacgtccatggtctatg
gaagctatcagattggttatcgaaaacttggaagattcttataactttgatcctaagaat
ccaacacttcgtggagaacaagcacgtgaaaatatgcattatgcagcaactttagcaggt
atggccttctcaaatgccttccttggaattaaccactcacttgctcacaagactggcggt
gaatttggccttcctcatggtcttgctatctcaattgctatgcagcatgttattcgctac
aatggcgttgcaggaaatgtgaaacgttctgtttacccgcgttatgaagaataccgtgcc
caacgtgattatgcggatattgctcgcgctcttggacttaaagggaaagatgatgcagaa
ttggttgaagcactctgtgcacgtattgatcaattaatgcatgctgtagatgttgagcct
aagttatctgctaatggggttactaagaaggcttttgatgcagctgttgatagattggca
agcttggcttatgatgatcaatgtacaccagctaatccacgtcagccttacattgaagag
atgaagcagctcttgattgatcagttctaa

DBGET integrated database retrieval system