KEGG   Streptococcus mutans GS-5: SMUGS5_01340Help
Entry
SMUGS5_01340      CDS       T02185                                 

Gene name
gltX
Definition
glutamyl-tRNA ligase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
smut  Streptococcus mutans GS-5
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:smut00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    SMUGS5_01340 (gltX)
Enzymes [BR:smut01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     SMUGS5_01340 (gltX)
Amino acid related enzymes [BR:smut01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   SMUGS5_01340 (gltX)
Transfer RNA biogenesis [BR:smut03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SMUGS5_01340 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
288477..289934
Genome map
AA seq 485 aa AA seqDB search
MTNKIRVRYAPSPTGLLHIGNARTALFNYLYARHHGGDFIIRIEDTDRKRHVEDGERSQL
ENLRWLGMDWDESPETHENYRQSERLALYKKYIDQLLAEGKAYKSYVTEEELATERERQE
AAGETPRYINEFLGMSADEKAAYIAKRQAAGIVPTVRLKVNEAGIYKWHDMVKGDIEFEG
GNIGGDWVIQKKDGYPTYNFAVVVDDHDMQISHVIRGDDHIANTPKQLMVYEALGWEAPA
FAHMTLIINSETGKKLSKRDTNTLQFIEDYRQKGYLPEAVFNFIALLGWNPGGENEIFSR
QELIELFDENRLSKSPAAFDQKKLDWMNNEYIKNADFDTIFALAKPYLESAGRLTDKAKK
LVELYQPQMKSIDEIVPLTDLFFEEFPELSEEEKEFMAGETVPIVLQAFKEKLEAMSDED
FKSENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPDTIFLLGKEKSIQHLEDM
LEKLK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacaaaattcgtgtgcgttatgcaccaagtccaacaggattgttacacattgga
aatgcacgtactgcgctctttaattatctctatgcgcgtcatcatggtggcgattttatc
attcgtattgaagatacggatcgtaagcgccatgttgaggatggggaacgctcccagctt
gaaaatctgcgttggttgggcatggattgggatgaaagtcctgaaacgcatgaaaattat
cgtcaatcagaacgtttagcactttataaaaaatacattgaccaactcttggctgaagga
aaagcttataaatcttatgtaacggaagaagaattagctacagaacgtgaacgtcaagaa
gcagctggtgaaacacctcgctatatcaatgaatttctcggtatgtcagcagatgaaaag
gctgcctacatcgcaaaacggcaagcagctggtattgtgccaacggttcgtttaaaagtc
aatgaagctggtatttataaatggcatgatatggttaaaggtgatattgaatttgaaggt
ggcaatattggtggtgactgggttatccaaaagaaagacggttacccaacctataatttt
gccgttgtagtggacgatcacgacatgcaaatttctcatgttattcgtggtgatgaccat
attgccaatacgccaaaacaactcatggtttacgaagcacttggctgggaagcgccagca
tttgctcacatgactcttatcatcaactcggaaacgggaaagaaactatccaaacgtgat
accaataccctacagtttatcgaagattatcgtcagaaagggtatctgccagaagctgtt
ttcaatttcatcgctcttcttggttggaatcctggtggggaaaacgaaattttttcacgt
caagaattgattgaactctttgatgaaaatcgccttagcaagtcaccagccgcctttgat
cagaagaaattggactggatgaataatgaatacatcaaaaatgccgattttgatacgatt
tttgctttggcaaaaccttatttagaatcagctggtcgtttgacagataaggctaaaaaa
ttggttgagctctatcagccacagatgaaatctattgatgaaattgtgcctttaacggat
cttttctttgaagagtttccagaattgtcagaagaggaaaaagaattcatggctggtgaa
acagttccaattgttctccaagccttcaaggaaaaattggaagccatgtcagatgaagat
ttcaaatcggaaaatatttttccgcaaattaaagccgttcaaaaagaaacgggcatcaag
gggaaaaatcttttcatgccaattcgtattgccgtttcaggtgaaatgcatgggccagaa
ttaccagatacaatcttcttactaggtaaggaaaaatccattcagcatcttgaagatatg
cttgaaaaattgaaataa

DBGET integrated database retrieval system