KEGG   Streptococcus mutans GS-5: SMUGS5_02360Help
Entry
SMUGS5_02360      CDS       T02185                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
smut  Streptococcus mutans GS-5
Pathway
smut00260  Glycine, serine and threonine metabolism
smut00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smut01100  Metabolic pathways
smut01110  Biosynthesis of secondary metabolites
smut01130  Biosynthesis of antibiotics
smut01230  Biosynthesis of amino acids
Module
smut_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smut00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMUGS5_02360
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SMUGS5_02360
Enzymes [BR:smut01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SMUGS5_02360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFM80999
Position
494504..495715
Genome map
AA seq 403 aa AA seqDB search
MTYNQPNNNGFYGNFGGQFIPETLMTAVIELDEAYREAKADPSFHEELDALLKDYVGRET
PLYFAKRLTDYIGGAKIYLKREDLNHTGAHKINNALGQVLLAKRMGKNKIIAETGAGQHG
VATATAAALFDMECTIYMGEEDVKRQALNVFRMELLGAKVHSVTDGSRVLKDAVNAALRA
WVTNIEDTHYVMGSALGPAPFPEIVRDFQSVIGREAKRQFATVSNGQLPDAVLACIGGGS
NAIGLFYPFVNDESVAMYGAEASGLGLDTDKHAATFAKGRPGVLHGALMDVLQDEHGQIM
EAFSISAGLDYPGVGPEHCYFNEIGRATYDSITDEEALESFKLLSRLEGIIPALESSHAI
ALTQKVAKELGADKSIIVCLSGRGDKDVAQVKERLKQEAKEGK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgacatataatcaacccaataacaacggtttttatggtaattttggaggacaattcatt
cctgaaacgctgatgacagctgttattgaattggatgaggcttatcgtgaagccaaagct
gatcctagttttcatgaagaattagatgctctcttaaaagattatgttggtcgtgaaact
cccttgtactttgctaaacgtttgacggattatattggtggtgccaaaatttatctaaaa
cgtgaagatcttaatcatacaggtgctcacaaaatcaataatgcactggggcaagttctt
ttagctaagcgtatggggaaaaataagattattgctgaaacaggtgcaggacagcatggt
gttgcaacagcaacagcagcggctctctttgatatggaatgtaccatttatatgggggaa
gaagatgtgaaacgtcaagctcttaatgtctttcggatggagctattaggtgctaaagtg
cattctgttacggatggatcgcgtgtgcttaaagatgcagtcaatgcagctttgcgagca
tgggtaaccaatattgaggatacccattatgttatgggatctgctcttggaccagctcct
ttcccagaaattgttcgtgatttccaatcggttattggcagagaagctaaacgtcaattt
gcgacagtttcaaatggacagctgccagatgcagtcttagcttgtatcggtggcggctcc
aatgcaatcggactcttttatccttttgtcaacgatgaatcagttgccatgtatggtgcg
gaagcgtcaggtttagggcttgataccgataagcatgcggcaacctttgccaaaggacga
ccaggtgttttacatggtgctcttatggatgtgctgcaggatgagcatggacagattatg
gaagctttctcgatttccgcgggccttgactatccaggtgttggtcctgaacactgctat
ttcaatgaaattggacgtgcaacttacgattctattacggatgaagaagctctggaatct
ttcaaattgctatctcgtctggaaggcattattcctgcattagaatctagtcatgcgatt
gctctgacacaaaaagttgcgaaggaactaggagcggataagtccattattgtttgcctc
tcaggacgtggtgataaggatgtggctcaggttaaagaacgtcttaagcaggaagcaaaa
gaagggaagtag

DBGET integrated database retrieval system