KEGG   Streptococcus mutans GS-5: SMUGS5_02385Help
Entry
SMUGS5_02385      CDS       T02185                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
smut  Streptococcus mutans GS-5
Pathway
smut00010  Glycolysis / Gluconeogenesis
smut00052  Galactose metabolism
smut00500  Starch and sucrose metabolism
smut00520  Amino sugar and nucleotide sugar metabolism
smut00521  Streptomycin biosynthesis
smut01100  Metabolic pathways
smut01110  Biosynthesis of secondary metabolites
smut01120  Microbial metabolism in diverse environments
smut01130  Biosynthesis of antibiotics
smut01200  Carbon metabolism
Module
smut_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
smut_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smut00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMUGS5_02385
   00052 Galactose metabolism
    SMUGS5_02385
   00500 Starch and sucrose metabolism
    SMUGS5_02385
   00520 Amino sugar and nucleotide sugar metabolism
    SMUGS5_02385
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SMUGS5_02385
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SMUGS5_02385
Enzymes [BR:smut01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SMUGS5_02385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AFM81004
Position
498428..499399
Genome map
AA seq 323 aa AA seqDB search
MAKKLLGIDLGGTSIKFGILTLDGQVQEKWAIETNILEDGKHIVPDIVSSIKHRLGLYNL
TKEDFVGIGMGSPGAVDRNLKTVTGAFNLNWAATQEVGTIIEAELGIPFAIDNDANVAAL
GERWVGAGNNNPDVVFVTLGTGVGGGIIADGNLIHGVAGAGGEIGHIIVEPDTGFECTCG
NKGCLETVASATGVVRVARHLAEEYEGISSIKAGIDNGDDVSSKDIFVAAQAGDKFANSV
VEKVTFYLGLATANISNILNPNTVVVGGGVSAAGEFLRSHIESYFKLYAFPQVKQSTKIK
IAELGNDAGIIGAASLAHQFLES
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaaacttttagggattgatcttggtggaacaagtattaaatttgggatttta
actttagatggacaagttcaggagaaatgggctattgaaaccaatattttggaagatggg
aaacatattgttccagatattgtgtcctctatcaagcatcgtttgggactctataattta
actaaggaggattttgttggtattggaatgggatctcctggagctgtggatcgtaatcta
aagactgttacaggtgcttttaatcttaattgggctgctacccaagaggtaggaacaata
attgaagcagaattggggataccatttgctattgataatgatgctaatgttgcagcactt
ggagaacgctgggttggtgcgggtaataataatcctgatgttgtctttgtaacacttggt
acaggtgttggcggcggtattattgctgatggcaatcttattcatggagttgctggtgca
ggtggtgaaattggacatattattgttgagccggatactggttttgagtgtacctgtggc
aataaaggctgtcttgaaacagtggcttcagcaacaggtgtcgtccgtgttgcacgtcat
ttagcagaagaatatgaaggaatttccagtattaaagcgggcattgataatggtgatgat
gtgagcagtaaggatatttttgttgctgcacaggcaggtgataaatttgcaaactcagtt
gttgagaaagttactttctatctaggccttgcaaccgccaatatcagcaatatccttaat
ccaaacacagttgtcgttggaggtggagtatcagctgctggagaattcttgcgctcacat
attgaaagttattttaaattgtatgcttttccacaagtgaagcaatctacaaaaattaaa
attgcggaattaggaaatgacgctggtattattggggcagccagtcttgcacatcagttt
ttagaaagttaa

DBGET integrated database retrieval system