KEGG   Streptococcus mutans GS-5: SMUGS5_02385Help
Entry
SMUGS5_02385      CDS       T02185                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
smut  Streptococcus mutans GS-5
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:smut01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:smut00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:smut00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:smut00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:smut00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:smut00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
498428..499399
Genome map
AA seq 323 aa AA seqDB search
MAKKLLGIDLGGTSIKFGILTLDGQVQEKWAIETNILEDGKHIVPDIVSSIKHRLGLYNL
TKEDFVGIGMGSPGAVDRNLKTVTGAFNLNWAATQEVGTIIEAELGIPFAIDNDANVAAL
GERWVGAGNNNPDVVFVTLGTGVGGGIIADGNLIHGVAGAGGEIGHIIVEPDTGFECTCG
NKGCLETVASATGVVRVARHLAEEYEGISSIKAGIDNGDDVSSKDIFVAAQAGDKFANSV
VEKVTFYLGLATANISNILNPNTVVVGGGVSAAGEFLRSHIESYFKLYAFPQVKQSTKIK
IAELGNDAGIIGAASLAHQFLES
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaaacttttagggattgatcttggtggaacaagtattaaatttgggatttta
actttagatggacaagttcaggagaaatgggctattgaaaccaatattttggaagatggg
aaacatattgttccagatattgtgtcctctatcaagcatcgtttgggactctataattta
actaaggaggattttgttggtattggaatgggatctcctggagctgtggatcgtaatcta
aagactgttacaggtgcttttaatcttaattgggctgctacccaagaggtaggaacaata
attgaagcagaattggggataccatttgctattgataatgatgctaatgttgcagcactt
ggagaacgctgggttggtgcgggtaataataatcctgatgttgtctttgtaacacttggt
acaggtgttggcggcggtattattgctgatggcaatcttattcatggagttgctggtgca
ggtggtgaaattggacatattattgttgagccggatactggttttgagtgtacctgtggc
aataaaggctgtcttgaaacagtggcttcagcaacaggtgtcgtccgtgttgcacgtcat
ttagcagaagaatatgaaggaatttccagtattaaagcgggcattgataatggtgatgat
gtgagcagtaaggatatttttgttgctgcacaggcaggtgataaatttgcaaactcagtt
gttgagaaagttactttctatctaggccttgcaaccgccaatatcagcaatatccttaat
ccaaacacagttgtcgttggaggtggagtatcagctgctggagaattcttgcgctcacat
attgaaagttattttaaattgtatgcttttccacaagtgaagcaatctacaaaaattaaa
attgcggaattaggaaatgacgctggtattattggggcagccagtcttgcacatcagttt
ttagaaagttaa

DBGET integrated database retrieval system