KEGG   Streptococcus mutans GS-5: SMUGS5_03150Help
Entry
SMUGS5_03150      CDS       T02185                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
smut  Streptococcus mutans GS-5
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:smut00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMUGS5_03150 (tpiA)
   01230 Biosynthesis of amino acids
    SMUGS5_03150 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMUGS5_03150 (tpiA)
   00051 Fructose and mannose metabolism
    SMUGS5_03150 (tpiA)
   00562 Inositol phosphate metabolism
    SMUGS5_03150 (tpiA)
Enzymes [BR:smut01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SMUGS5_03150 (tpiA)
Exosome [BR:smut04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SMUGS5_03150 (tpiA)
  Exosomal proteins of bladder cancer cells
   SMUGS5_03150 (tpiA)
  Exosomal proteins of melanoma cells
   SMUGS5_03150 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
664828..665586
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKMNKTAAEAREFIDAVKNNIPSNNLVDTVIGSPALFLEGMKKGVKDTEL
QVAAQNCYWEDFGAFTGETSPAALAALGVDYVIIGHSERRDYFHETDQEINKKAHAIFKH
KMTPILCCGESLETYEAGKTAEWIEGQITADLKGLSAEQVSSMVIAYEPIWAIGTGKSAD
ANIADDICGVVRATVEKLYGKEVAQAVRIQYGGSVKPENVAEYMAKENVDGALVGGASLQ
ADSFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaattattgctggtaactggaaaatgaacaagactgctgctgaagcg
cgtgagttcattgatgcagttaagaacaatattccttcaaataatcttgttgatactgtt
atcggatcacctgcattattccttgaaggaatgaaaaaaggcgtgaaagatacagaattg
caagttgcagctcaaaactgttactgggaagattttggtgcttttactggtgaaacaagt
cctgcagcgcttgcagcacttggtgttgattatgttattattgggcactcagaacgtcgt
gattacttccatgaaacagatcaagagattaacaaaaaagcacatgctatttttaagcac
aagatgacgccaattctttgctgtggtgaatctcttgaaacttatgaagcaggtaaaaca
gctgagtggattgaaggacaaatcactgctgaccttaagggcttgagtgctgagcaagta
tcaagtatggttatcgcttatgaaccaatttgggctattggtactggtaagtcagctgat
gctaatattgcagatgatatctgtggtgttgttcgtgcaaccgttgaaaaactttatgga
aaagaagttgctcaggctgtccgtattcaatacggcggttctgtaaaacctgaaaatgtt
gcagaatacatggctaaagaaaatgttgatggtgctcttgttggcggtgcttcattgcaa
gcagacagtttccttgcccttcttgactttgtcaaataa

DBGET integrated database retrieval system